Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

Limk2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei360ATPPROSITE-ProRule annotation1
Active sitei451By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi337 – 345ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: MGI
  • protein kinase activity Source: MGI
  • protein serine/threonine kinase activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:Limk2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1197517 Limk2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758101 – 638LIM domain kinase 2Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei210PhosphothreonineBy similarity1
Modified residuei293PhosphoserineBy similarity1
Modified residuei298PhosphoserineBy similarity1
Modified residuei505Phosphothreonine; by ROCK1 and CDC42BPBy similarity1

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO54785
PeptideAtlasiO54785
PRIDEiO54785

PTM databases

iPTMnetiO54785
PhosphoSitePlusiO54785

Expressioni

Tissue specificityi

Isoform 3 is testis specific.

Gene expression databases

BgeeiENSMUSG00000020451 Expressed in 284 organ(s), highest expression level in placenta
CleanExiMM_LIMK2
ExpressionAtlasiO54785 baseline and differential
GenevisibleiO54785 MM

Interactioni

Subunit structurei

Binds ROCK1 and MARF1 (By similarity). Interacts with PARD3 (By similarity). Interacts with NISCH.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi201167, 2 interactors
STRINGi10090.ENSMUSP00000099162

Structurei

Secondary structure

1638
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO54785
SMRiO54785
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO54785

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 63LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST52
Domaini72 – 124LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST53
Domaini152 – 239PDZPROSITE-ProRule annotationAdd BLAST88
Domaini331 – 608Protein kinasePROSITE-ProRule annotationAdd BLAST278

Sequence similaritiesi

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410IEZ9 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00530000063025
HOGENOMiHOG000013121
HOVERGENiHBG052328
InParanoidiO54785
KOiK05744
OrthoDBiEOG091G03ZL
PhylomeDBiO54785
TreeFamiTF318014

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
PF00595 PDZ, 1 hit
PF07714 Pkinase_Tyr, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits
PS50106 PDZ, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O54785-1) [UniParc]FASTAAdd to basket
Also known as: LIMK2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALAGDEAW RCRGCGTYVP LSQRLYRTAN EAWHGSCFRC SECQESLTNW
60 70 80 90 100
YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV
160 170 180 190 200
TLISMPATTE CRRGFSVTVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAIKQTSQT LQLLIEHDPV PQRLDQLRLD
260 270 280 290 300
ARLPPHMQST GHTLMLSTLD TKENQEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRSV DPFPWQQKVR FAKGISSGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKATT KKRTLRKSDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS
610 620 630
FEALSLFLGE LAIPLPAELE DLDHTVSMEY GLTRDSPP
Length:638
Mass (Da):72,202
Last modified:August 1, 1998 - v2
Checksum:i54CFA5E7A6A79C39
GO
Isoform 2 (identifier: O54785-2) [UniParc]FASTAAdd to basket
Also known as: LIMK2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSC → MGSYLSVPAYFTSRDP

Show »
Length:617
Mass (Da):69,891
Checksum:i1E2DCE61958B8D0B
GO
Isoform 3 (identifier: O54785-3) [UniParc]FASTAAdd to basket
Also known as: LIMK2t, tLIMK2

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:451
Mass (Da):51,173
Checksum:i883063D71E077C2B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5NC03Q5NC03_MOUSE
LIM domain kinase 2
Limk2
623Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0103511 – 187Missing in isoform 3. 2 PublicationsAdd BLAST187
Alternative sequenceiVSP_0103501 – 37MAALA…WHGSC → MGSYLSVPAYFTSRDP in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA Translation: BAA29035.1
AB005140 Genomic DNA Translation: BAA24491.1
AB005131 mRNA Translation: BAA24488.1
AB005132 mRNA Translation: BAA24489.1
AB005134 Genomic DNA Translation: BAA24490.1
U88618 mRNA Translation: AAC39947.1
AB012291 mRNA Translation: BAA32437.1
AB012092 mRNA Translation: BAA31147.1
BC007129 mRNA Translation: AAH07129.1
CCDSiCCDS24358.1 [O54785-1]
CCDS24359.1 [O54785-2]
CCDS24360.1 [O54785-3]
PIRiJC5813
JC5814
JE0240
RefSeqiNP_001029202.1, NM_001034030.2 [O54785-3]
NP_034848.1, NM_010718.4 [O54785-1]
NP_774958.1, NM_173053.1 [O54785-2]
UniGeneiMm.124176
Mm.390323
Mm.442189

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451 [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451 [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451 [O54785-3]
GeneIDi16886
KEGGimmu:16886
UCSCiuc007hss.1 mouse [O54785-1]
uc007hst.1 mouse [O54785-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB008117 mRNA Translation: BAA29035.1
AB005140 Genomic DNA Translation: BAA24491.1
AB005131 mRNA Translation: BAA24488.1
AB005132 mRNA Translation: BAA24489.1
AB005134 Genomic DNA Translation: BAA24490.1
U88618 mRNA Translation: AAC39947.1
AB012291 mRNA Translation: BAA32437.1
AB012092 mRNA Translation: BAA31147.1
BC007129 mRNA Translation: AAH07129.1
CCDSiCCDS24358.1 [O54785-1]
CCDS24359.1 [O54785-2]
CCDS24360.1 [O54785-3]
PIRiJC5813
JC5814
JE0240
RefSeqiNP_001029202.1, NM_001034030.2 [O54785-3]
NP_034848.1, NM_010718.4 [O54785-1]
NP_774958.1, NM_173053.1 [O54785-2]
UniGeneiMm.124176
Mm.390323
Mm.442189

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUBNMR-A142-246[»]
ProteinModelPortaliO54785
SMRiO54785
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi201167, 2 interactors
STRINGi10090.ENSMUSP00000099162

PTM databases

iPTMnetiO54785
PhosphoSitePlusiO54785

Proteomic databases

PaxDbiO54785
PeptideAtlasiO54785
PRIDEiO54785

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000101638; ENSMUSP00000099162; ENSMUSG00000020451 [O54785-1]
ENSMUST00000101642; ENSMUSP00000099165; ENSMUSG00000020451 [O54785-2]
ENSMUST00000110029; ENSMUSP00000105656; ENSMUSG00000020451 [O54785-3]
GeneIDi16886
KEGGimmu:16886
UCSCiuc007hss.1 mouse [O54785-1]
uc007hst.1 mouse [O54785-2]

Organism-specific databases

CTDi3985
MGIiMGI:1197517 Limk2

Phylogenomic databases

eggNOGiENOG410IEZ9 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00530000063025
HOGENOMiHOG000013121
HOVERGENiHBG052328
InParanoidiO54785
KOiK05744
OrthoDBiEOG091G03ZL
PhylomeDBiO54785
TreeFamiTF318014

Miscellaneous databases

EvolutionaryTraceiO54785
PROiPR:O54785
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020451 Expressed in 284 organ(s), highest expression level in placenta
CleanExiMM_LIMK2
ExpressionAtlasiO54785 baseline and differential
GenevisibleiO54785 MM

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
PF00595 PDZ, 1 hit
PF07714 Pkinase_Tyr, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits
PS50106 PDZ, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLIMK2_MOUSE
AccessioniPrimary (citable) accession number: O54785
Secondary accession number(s): O54776, O55238, Q9QUL4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: August 1, 1998
Last modified: November 7, 2018
This is version 156 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again