Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O48782 (HMOX1_ARATH)

Entry version 133 (02 Dec 2020)
Sequence version 2 (01 Nov 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Heme oxygenase 1, chloroplastic

Gene

HO1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors. Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO). Produces specifically the biliverdin IX-alpha isomer. Can form complex with heme, is ferredoxin-dependent and its activity is increased in the presence of ascorbate. Plays a role in salt acclimation signaling. May affect the plastid-to-nucleus signaling pathway by perturbing tetrapyrrole synthesis. The plastid-to-nucleus signal plays an important role in the coordinated expression of both nuclear- and chloroplast-localized genes that encode photosynthesis-related proteins.12 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by ascorbate.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=1.3 µM for hemin2 Publications
  2. KM=1.9 µM for ferredoxin2 Publications
  3. KM=420 µM for ascorbate2 Publications

    pH dependencei

    Optimum pH is 7.2.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi86Iron (heme axial ligand)By similarity1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    Biological processPhotosynthesis
    LigandHeme, Iron, Metal-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...    BioCyci    		ARA:AT2G26670-MONOMER
    MetaCyc:AT2G26670-MONOMER

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Heme oxygenase 1, chloroplastic (EC:1.14.14.182 Publications)
    Short name:
    AtHO1
    Alternative name(s):
    Protein GENOMES UNCOUPLED 2
    Protein REVERSAL OF THE DET PHENOTYPE 4
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:HO1
    Synonyms:GUN2, HY1, HY6, TED4
    Ordered Locus Names:At2g26670
    ORF Names:F18A8.4
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliopsida › eudicotyledons › Gunneridae › Pentapetalae › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

    Organism-specific databases

    Arabidopsis Information Portal

    More...    Araporti    		AT2G26670

    The Arabidopsis Information Resource

    More...    TAIRi    		locus:2005513, AT2G26670

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Chloroplast, Plastid

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

    Long hypocotyl, incomplete chloroplast and leaf development, lack of photoreversible phytochromes and lack of phytochromobilin, the phytochrome chromophore. No cotyledon expansion in response to bright-red light. Increased levels of jasmonate (JA) and constitutive expression of JA-inducible defense genes. Increased sensitivity to salt stress and no acclimation response to salinity.11 Publications

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 54ChloroplastSequence analysisAdd BLAST54
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041218555 – 282Heme oxygenase 1, chloroplasticAdd BLAST228

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		O48782

    PRoteomics IDEntifications database

    More...    PRIDEi    		O48782

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		232086 [O48782-1]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		O48782

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed.3 Publications

    <p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    By salt treatment. Down-regulated by jasmonate.2 Publications

    Gene expression databases

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		O48782, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		O48782, AT

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		2560, 1 interactor

    STRING: functional protein association networks

    More...    STRINGi    		3702.AT2G26670.1

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the heme oxygenase family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG4480, Eukaryota

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_063325_1_1_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		O48782

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		YNFYFAH

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		O48782

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		1.20.910.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR016053, Haem_Oase-like
    IPR016084, Haem_Oase-like_multi-hlx
    IPR016951, Haem_Oase_decyc_pln

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF01126, Heme_oxygenase, 1 hit

    PIRSF; a whole-protein classification database

    More...    PIRSFi    		PIRSF030219, Heme_Oase_decyc_pln, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF48613, SSF48613, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: O48782-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MAYLAPISSS LSIFKNPQLS RFQFSSSSPN PLFLRPRIQI LSMTMNKSPS 
            60         70         80         90        100
    LVVVAATTAA EKQKKRYPGE SKGFVEEMRF VAMRLHTKDQ AKEGEKETKS 
           110        120        130        140        150
    IEERPVAKWE PTVEGYLRFL VDSKLVYDTL ELIIQDSNFP TYAEFKNTGL 
           160        170        180        190        200
    ERAEKLSTDL EWFKEQGYEI PEPTAPGKTY SQYLKELAEK DPQAFICHFY 
           210        220        230        240        250
    NIYFAHSAGG RMIGRKVAER ILDNKELEFY KWDGELSQLL QNVREKLNKV 
           260        270        280 
    AEEWTREEKN HCLEETEKSF KYSGEILRLI LS
    Length:282
    Mass (Da):32,691
    Last modified:November 1, 1999 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65D9638890A3E8BA
    GO
    Isoform 2 (identifier: O48782-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         94-142: GEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTY → D

    Show »
    Length:234
    Mass (Da):27,076
    Checksum:iD5350323BB620A1E
    GO

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAK52998 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04165294 – 142GEKET…NFPTY → D in isoform 2. CuratedAdd BLAST49

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		AB021857 Genomic DNA Translation: BAA77758.1
    AB021858 mRNA Translation: BAA77759.1
    AF132475 Genomic DNA Translation: AAD22107.1
    AF132476 Genomic DNA Translation: AAD22108.1
    AC003105 Genomic DNA Translation: AAB95301.2
    CP002685 Genomic DNA Translation: AEC07872.1
    CP002685 Genomic DNA Translation: AEC07873.1
    AF327418 mRNA Translation: AAG42008.2
    AF375414 mRNA Translation: AAK52998.1 Different initiation.
    AY129477 mRNA Translation: AAM91063.1
    BT002327 mRNA Translation: AAN86160.1
    AY087288 mRNA Translation: AAM64841.1

    Protein sequence database of the Protein Information Resource

    More...    PIRi    		T52457

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001118392.1, NM_001124920.1 [O48782-2]
    NP_180235.1, NM_128224.3 [O48782-1]

    Genome annotation databases

    Ensembl plant genome annotation project

    More...    EnsemblPlantsi    		AT2G26670.1; AT2G26670.1; AT2G26670 [O48782-1]
    AT2G26670.2; AT2G26670.2; AT2G26670 [O48782-2]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		817208

    Gramene; a comparative resource for plants

    More...    Gramenei    		AT2G26670.1; AT2G26670.1; AT2G26670 [O48782-1]
    AT2G26670.2; AT2G26670.2; AT2G26670 [O48782-2]

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		ath:AT2G26670

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		AB021857 Genomic DNA Translation: BAA77758.1
    AB021858 mRNA Translation: BAA77759.1
    AF132475 Genomic DNA Translation: AAD22107.1
    AF132476 Genomic DNA Translation: AAD22108.1
    AC003105 Genomic DNA Translation: AAB95301.2
    CP002685 Genomic DNA Translation: AEC07872.1
    CP002685 Genomic DNA Translation: AEC07873.1
    AF327418 mRNA Translation: AAG42008.2
    AF375414 mRNA Translation: AAK52998.1 Different initiation.
    AY129477 mRNA Translation: AAM91063.1
    BT002327 mRNA Translation: AAN86160.1
    AY087288 mRNA Translation: AAM64841.1
    PIRiT52457
    RefSeqiNP_001118392.1, NM_001124920.1 [O48782-2]
    NP_180235.1, NM_128224.3 [O48782-1]

    3D structure databases

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    SWISS-MODEL Interactive Workspace

    More...    SWISS-MODEL-Workspacei    		Submit a new modelling project...

    Protein-protein interaction databases

    BioGRIDi2560, 1 interactor
    STRINGi3702.AT2G26670.1

    PTM databases

    iPTMnetiO48782

    Proteomic databases

    PaxDbiO48782
    PRIDEiO48782
    ProteomicsDBi232086 [O48782-1]

    Genome annotation databases

    EnsemblPlantsiAT2G26670.1; AT2G26670.1; AT2G26670 [O48782-1]
    AT2G26670.2; AT2G26670.2; AT2G26670 [O48782-2]
    GeneIDi817208
    GrameneiAT2G26670.1; AT2G26670.1; AT2G26670 [O48782-1]
    AT2G26670.2; AT2G26670.2; AT2G26670 [O48782-2]
    KEGGiath:AT2G26670

    Organism-specific databases

    AraportiAT2G26670
    TAIRilocus:2005513, AT2G26670

    Phylogenomic databases

    eggNOGiKOG4480, Eukaryota
    HOGENOMiCLU_063325_1_1_1
    InParanoidiO48782
    OMAiYNFYFAH
    PhylomeDBiO48782

    Enzyme and pathway databases

    BioCyciARA:AT2G26670-MONOMER
    MetaCyc:AT2G26670-MONOMER

    Miscellaneous databases

    Protein Ontology

    More...    PROi    		PR:O48782

    Gene expression databases

    ExpressionAtlasiO48782, baseline and differential
    GenevisibleiO48782, AT

    Family and domain databases

    Gene3Di1.20.910.10, 1 hit
    InterProiView protein in InterPro
    IPR016053, Haem_Oase-like
    IPR016084, Haem_Oase-like_multi-hlx
    IPR016951, Haem_Oase_decyc_pln
    PfamiView protein in Pfam
    PF01126, Heme_oxygenase, 1 hit
    PIRSFiPIRSF030219, Heme_Oase_decyc_pln, 1 hit
    SUPFAMiSSF48613, SSF48613, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHMOX1_ARATH
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O48782
    Secondary accession number(s): B3H4A6, Q7E9A5, Q9FPE3
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 27, 2011
    Last sequence update: November 1, 1999
    Last modified: December 2, 2020
    This is version 133 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again