Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (11 Dec 2019)
Sequence version 2 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Matrix metalloproteinase-B

Gene

zmp-2

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloprotease involved in molting, a process during larval stages in which a new cuticle is formed and the old cuticle is shed (PubMed:24957743). Plays a role in thermotolerance probably by preventing the accumulation of oxidized lipoproteins and cholesterol (PubMed:20600277, PubMed:24957743).2 Publications

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by human TIMP1 and TIMP2 and the broad MMP inhibitors BB94 (Batimastat) and CT543.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi111Zinc 2; in inhibited formBy similarity1
Metal bindingi208Zinc 1By similarity1
Metal bindingi210Zinc 1By similarity1
Metal bindingi232Zinc 1By similarity1
Metal bindingi247Zinc 1By similarity1
Metal bindingi276Zinc 2; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei277By similarity1
Metal bindingi280Zinc 2; catalyticBy similarity1
Metal bindingi286Zinc 2; catalyticBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • metalloendopeptidase activity Source: GO_Central
  • metallopeptidase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1442490 Collagen degradation
R-CEL-1474228 Degradation of the extracellular matrix
R-CEL-1592389 Activation of Matrix Metalloproteinases
R-CEL-2168880 Scavenging of heme from plasma
R-CEL-6798695 Neutrophil degranulation

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M10.068

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Matrix metalloproteinase-B1 Publication (EC:3.4.24.-1 Publication)
Short name:
MMP-B1 Publication
Short name:
MMP-H191 Publication
Alternative name(s):
Zinc metalloprotease 2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:zmp-2Imported
ORF Names:H19M22.3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegansImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome III

Organism-specific databases

WormBase

More...
WormBasei
H19M22.3a ; CE26937 ; WBGene00019212 ; zmp-2
H19M22.3b ; CE29414 ; WBGene00019212 ; zmp-2
H19M22.3c ; CE34904 ; WBGene00019212 ; zmp-2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown causes a delay in larval to adult development with reduced motility and feeding (PubMed:20600277). Also reduces fecundity in adults (PubMed:20600277). Larvae have molting defects characterized by incomplete cuticle shedding leaving a constriction ring in the larvae anterior part (PubMed:20600277). Reduces survival upon Gram-negative bacterium P.luminescense infection or heat stress (PubMed:20600277, PubMed:24957743). Production of extra- and intra-cellular reactive oxygen species (ROS) and protein oxidation are increased whereas vit-6 transcription and dehydroergosterol (DHE) uptake are reduced (PubMed:24957743). Moreover, causes constitutive daf-16 nuclear localization (PubMed:24957743). Simultaneous RNAi-mediated knockdown of vit-6, rme-2, daf-16 or daf-16 coactivators sir2.1, ftt-2 and par-2 restores normal thermotolerance (PubMed:24957743). RNAi-mediated knockdown in a daf-9 or daf-12 mutant background reduces survival further upon heat stress.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000043923227 – 126Activation peptideBy similarityAdd BLAST100
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_5004158457126 – 519Matrix metalloproteinase-BCuratedAdd BLAST394

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi341N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi408N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Zymogen

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O44836

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in spermatheca and spermathecal-uterine valve, weakly in vulva and anal muscles and in two cells in the head (probably RMEV and RMED motor neurons).1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at the comma, 1.5-fold and 3-fold embryonic stages in multiple cells including muscle and somatic gonad cells. In L1 larvae, predominantly expressed in specific muscles and somatic gonad cells, in L2 larvae predominantly expressed in muscles cells and in L4 larvae expressed predominantly in the developing spermatheca and more weakly in vulva muscle cells. Expression increases in the hypodermis in dauer stage larvae prior molting to L4 larval stage.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00019212 Expressed in 4 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.H19M22.3a

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi109 – 116Cysteine switchBy similarity8

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M10A family.SAAS annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1565 Eukaryota
ENOG410XQ5D LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000019059

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O44836

Identification of Orthologs from Complete Genome Data

More...
OMAi
ALMHPYY

Database of Orthologous Groups

More...
OrthoDBi
899924at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O44836

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04278 ZnMc_MMP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033739 M10A_MMP
IPR024079 MetalloPept_cat_dom_sf
IPR001818 Pept_M10_metallopeptidase
IPR021190 Pept_M10A
IPR006026 Peptidase_Metallo
IPR036365 PGBD-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00413 Peptidase_M10, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00138 MATRIXIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00235 ZnMc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47090 SSF47090, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00142 ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform aImported (identifier: O44836-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTKWSPNGNP LSTIYLILSL FTLAHTAPTT QHSRTTTQLR LEDEDGGGGV
60 70 80 90 100
DEDSIHFVKG QMEKYGYLKG IDHSSPQEFR QALMFFQEVL EVEQTGNVDE
110 120 130 140 150
MTVEAASKPR CTQTDVRQEQ TKRTKRFTLS KRAKWAHASG QSVTLKWYIS
160 170 180 190 200
DYTSDIDRLE TRKVVEKAFK LWSSQSYIKN EKKVTLTFQE ASSKDEADIN
210 220 230 240 250
ILWAEGNHGD EHDFDGANGK IEGNKKENVL AHTFFPGYAR PLNGDIHFDD
260 270 280 290 300
AEDWEIDVDQ VGHGSNKRFF PYVLAHEIGH ALGLDHSQKA DALMHPYYKN
310 320 330 340 350
VPINEIQLDI DDKCGVIWNY GGASDFCLYV WLMSQIVEAH NSSAQNNHGV
360 370 380 390 400
GSITSSRTNK KSFKSEGFFL FQLKFPHSTL THTDDVVMRE KDKRSYRGDS
410 420 430 440 450
KIPKCSSNNS SQRTLAEKKL TLGLHLSEAD AKRYTEMVCN FLAGLHMWRT
460 470 480 490 500
NPNHHASESL EKEYKGVSQE MGTFSGKSIA VRRLIRHAEH QKERSEKGPL
510
DPDYFDDDFF ENFFMEYSK
Length:519
Mass (Da):59,254
Last modified:June 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC02A8C11F6B263F4
GO
Isoform bImported (identifier: O44836-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-101: EVLEVEQTGNVDEM → VKFSRWNRLETSMR
     102-519: Missing.

Show »
Length:101
Mass (Da):11,610
Checksum:i7A871D6A18137DE2
GO
Isoform cImported (identifier: O44836-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-87: MTKWSPNGNP...EFRQALMFFQ → MARCRRISGG...ISASSHVLPS
     365-399: SEGFFLFQLKFPHSTLTHTDDVVMREKDKRSYRGD → N

Show »
Length:453
Mass (Da):51,390
Checksum:i27222F9398A8EA60
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA28352 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti348H → D in BAA28352 (PubMed:9573338).Curated1
Sequence conflicti365 – 398Missing in BAA28352 (PubMed:9573338).CuratedAdd BLAST34
Sequence conflicti435T → A in BAA28352 (PubMed:9573338).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0588081 – 87MTKWS…LMFFQ → MARCRRISGGGIRQKVFNTH NCASFSGSNGKVWLSQRHRS LVTARISASSHVLPS in isoform c. CuratedAdd BLAST87
Alternative sequenceiVSP_05880988 – 101EVLEV…NVDEM → VKFSRWNRLETSMR in isoform b. CuratedAdd BLAST14
Alternative sequenceiVSP_058810102 – 519Missing in isoform b. CuratedAdd BLAST418
Alternative sequenceiVSP_058811365 – 399SEGFF…SYRGD → N in isoform c. Add BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX284603 Genomic DNA Translation: CCD72394.1
BX284603 Genomic DNA Translation: CCD72395.1
BX284603 Genomic DNA Translation: CCD72396.1
AB007816 mRNA Translation: BAA28352.1 Sequence problems.

Protein sequence database of the Protein Information Resource

More...
PIRi
T37250

NCBI Reference Sequences

More...
RefSeqi
NP_497594.1, NM_065193.4 [O44836-1]
NP_497595.1, NM_065194.3
NP_497596.2, NM_065195.2 [O44836-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
H19M22.3a.1; H19M22.3a.1; WBGene00019212 [O44836-1]
H19M22.3b.1; H19M22.3b.1; WBGene00019212 [O44836-2]
H19M22.3c.1; H19M22.3c.1; WBGene00019212 [O44836-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
175383

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_H19M22.3

UCSC genome browser

More...
UCSCi
H19M22.3a c. elegans [O44836-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284603 Genomic DNA Translation: CCD72394.1
BX284603 Genomic DNA Translation: CCD72395.1
BX284603 Genomic DNA Translation: CCD72396.1
AB007816 mRNA Translation: BAA28352.1 Sequence problems.
PIRiT37250
RefSeqiNP_497594.1, NM_065193.4 [O44836-1]
NP_497595.1, NM_065194.3
NP_497596.2, NM_065195.2 [O44836-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi6239.H19M22.3a

Protein family/group databases

MEROPSiM10.068

Proteomic databases

PaxDbiO44836

Genome annotation databases

EnsemblMetazoaiH19M22.3a.1; H19M22.3a.1; WBGene00019212 [O44836-1]
H19M22.3b.1; H19M22.3b.1; WBGene00019212 [O44836-2]
H19M22.3c.1; H19M22.3c.1; WBGene00019212 [O44836-3]
GeneIDi175383
KEGGicel:CELE_H19M22.3
UCSCiH19M22.3a c. elegans [O44836-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
175383
WormBaseiH19M22.3a ; CE26937 ; WBGene00019212 ; zmp-2
H19M22.3b ; CE29414 ; WBGene00019212 ; zmp-2
H19M22.3c ; CE34904 ; WBGene00019212 ; zmp-2

Phylogenomic databases

eggNOGiKOG1565 Eukaryota
ENOG410XQ5D LUCA
HOGENOMiHOG000019059
InParanoidiO44836
OMAiALMHPYY
OrthoDBi899924at2759
PhylomeDBiO44836

Enzyme and pathway databases

ReactomeiR-CEL-1442490 Collagen degradation
R-CEL-1474228 Degradation of the extracellular matrix
R-CEL-1592389 Activation of Matrix Metalloproteinases
R-CEL-2168880 Scavenging of heme from plasma
R-CEL-6798695 Neutrophil degranulation

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O44836

Gene expression databases

BgeeiWBGene00019212 Expressed in 4 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

Family and domain databases

CDDicd04278 ZnMc_MMP, 1 hit
Gene3Di3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR033739 M10A_MMP
IPR024079 MetalloPept_cat_dom_sf
IPR001818 Pept_M10_metallopeptidase
IPR021190 Pept_M10A
IPR006026 Peptidase_Metallo
IPR036365 PGBD-like_sf
PfamiView protein in Pfam
PF00413 Peptidase_M10, 1 hit
PRINTSiPR00138 MATRIXIN
SMARTiView protein in SMART
SM00235 ZnMc, 1 hit
SUPFAMiSSF47090 SSF47090, 1 hit
PROSITEiView protein in PROSITE
PS00142 ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMMPB_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O44836
Secondary accession number(s): H2L0C2, O61265, Q95X57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2017
Last sequence update: June 1, 2001
Last modified: December 11, 2019
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  3. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again