Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (22 Apr 2020)
Sequence version 2 (02 Aug 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Prickle planar cell polarity protein 3

Gene

PRICKLE3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the planar cell polarity (PCP) pathway that is essential for the polarization of epithelial cells during morphogenetic processes, including gastrulation and neurulation (By similarity). PCP is maintained by two molecular modules, the global and the core modules, PRICKLE3 being part of the core module (By similarity). Distinct complexes of the core module segregate to opposite sides of the cell, where they interact with the opposite complex in the neighboring cell at or near the adherents junctions (By similarity). Involved in the organization of the basal body (By similarity). Involved in cilia growth and positioning (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O43900

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prickle planar cell polarity protein 3Imported
Alternative name(s):
LIM domain only protein 6
Short name:
LMO-6
Prickle-like protein 3
Short name:
Pk3Curated
Triple LIM domain protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRICKLE3Imported
Synonyms:LMO6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6645 PRICKLE3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300111 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43900

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4007

Open Targets

More...
OpenTargetsi
ENSG00000012211

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162400060

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O43900 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PRICKLE3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758221 – 615Prickle planar cell polarity protein 3Add BLAST615

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei475PhosphoserineCombined sources1
Modified residuei491PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O43900

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43900

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O43900

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43900

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43900

PeptideAtlas

More...
PeptideAtlasi
O43900

PRoteomics IDEntifications database

More...
PRIDEi
O43900

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
49223 [O43900-1]
6945

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43900

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43900

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000012211 Expressed in ectocervix and 92 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43900 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43900 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000012211 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with VANGL2 via its C-terminus (By similarity). The VANGL2-dependent membrane recruitment of PRICKLE3 is a prerequisite for its polarization (By similarity).

Interacts with WTIP. WTIP is involved in the recruitment of PRICKLE3 to the basal body (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110192, 72 interactors

Protein interaction database and analysis system

More...
IntActi
O43900, 67 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000470248

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O43900 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43900

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini74 – 182PETPROSITE-ProRule annotationAdd BLAST109
Domaini184 – 249LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST66
Domaini250 – 309LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini310 – 373LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST64

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi150 – 153Poly-Glu4
Compositional biasi513 – 522Poly-His10
Compositional biasi544 – 557Poly-SerAdd BLAST14

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the prickle / espinas / testin family.Curated

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1704 Eukaryota
ENOG410XP0W LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153629

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008937_8_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43900

KEGG Orthology (KO)

More...
KOi
K04511

Identification of Orthologs from Complete Genome Data

More...
OMAi
CTCYEAR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43900

TreeFam database of animal gene trees

More...
TreeFami
TF313265

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09415 LIM1_Prickle, 1 hit
cd09418 LIM2_Prickle, 1 hit
cd09420 LIM3_Prickle, 1 hit
cd09827 PET_Prickle, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033725 LIM1_prickle
IPR033726 LIM2_prickle
IPR033727 LIM3_prickle
IPR010442 PET_domain
IPR033723 PET_prickle
IPR001781 Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00412 LIM, 3 hits
PF06297 PET, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS51303 PET, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43900-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFARGSRRRR SGRAPPEAED PDRGQPCNSC REQCPGFLLH GWRKICQHCK
60 70 80 90 100
CPREEHAVHA VPVDLERIMC RLISDFQRHS ISDDDSGCAS EEYAWVPPGL
110 120 130 140 150
KPEQVYQFFS CLPEDKVPYV NSPGEKYRIK QLLHQLPPHD SEAQYCTALE
160 170 180 190 200
EEEKKELRAF SQQRKRENLG RGIVRIFPVT ITGAICEECG KQIGGGDIAV
210 220 230 240 250
FASRAGLGAC WHPQCFVCTT CQELLVDLIY FYHVGKVYCG RHHAECLRPR
260 270 280 290 300
CQACDEIIFS PECTEAEGRH WHMDHFCCFE CEASLGGQRY VMRQSRPHCC
310 320 330 340 350
ACYEARHAEY CDGCGEHIGL DQGQMAYEGQ HWHASDRCFC CSRCGRALLG
360 370 380 390 400
RPFLPRRGLI FCSRACSLGS EPTAPGPSRR SWSAGPVTAP LAASTASFSA
410 420 430 440 450
VKGASETTTK GTSTELAPAT GPEEPSRFLR GAPHRHSMPE LGLRSVPEPP
460 470 480 490 500
PESPGQPNLR PDDSAFGRQS TPRVSFRDPL VSEGGPRRTL SAPPAQRRRP
510 520 530 540 550
RSPPPRAPSR RRHHHHNHHH HHNRHPSRRR HYQCDAGSGS DSESCSSSPS
560 570 580 590 600
SSSSESSEDD GFFLGERIPL PPHLCRPMPA QDTAMETFNS PSLSLPRDSR
610
AGMPRQARDK NCIVA
Length:615
Mass (Da):68,609
Last modified:August 2, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCD024365C072B052
GO
Isoform 2 (identifier: O43900-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     106-142: YQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSE → TRGQPSTLAVQWVHTNAHTHTHTQ

Show »
Length:534
Mass (Da):59,097
Checksum:i7C2E745AEE1897E8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y413H0Y413_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
547Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRT7A0A0A0MRT7_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4N2F5H4N2_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZP7H7BZP7_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti185I → S in AAB92357 (PubMed:9344658).Curated1
Sequence conflicti370 – 509Missing in AAB92357 (PubMed:9344658).CuratedAdd BLAST140

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050169343R → C. Corresponds to variant dbSNP:rs7065449Ensembl.1
Natural variantiVAR_036188558E → D in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0565681 – 68Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_056569106 – 142YQFFS…PHDSE → TRGQPSTLAVQWVHTNAHTH THTQ in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ011654 mRNA Translation: CAA09726.1
BT007423 mRNA Translation: AAP36091.1
AK303308 mRNA Translation: BAH13938.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50686.1
BC002468 mRNA Translation: AAH02468.1
BC016856 mRNA Translation: AAH16856.1
U93305 Genomic DNA Translation: AAB92357.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14320.1 [O43900-1]

NCBI Reference Sequences

More...
RefSeqi
NP_006141.2, NM_006150.4 [O43900-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000599218; ENSP00000470248; ENSG00000012211 [O43900-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4007

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4007

UCSC genome browser

More...
UCSCi
uc004dmy.2 human [O43900-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011654 mRNA Translation: CAA09726.1
BT007423 mRNA Translation: AAP36091.1
AK303308 mRNA Translation: BAH13938.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50686.1
BC002468 mRNA Translation: AAH02468.1
BC016856 mRNA Translation: AAH16856.1
U93305 Genomic DNA Translation: AAB92357.1
CCDSiCCDS14320.1 [O43900-1]
RefSeqiNP_006141.2, NM_006150.4 [O43900-1]

3D structure databases

SMRiO43900
ModBaseiSearch...

Protein-protein interaction databases

BioGridi110192, 72 interactors
IntActiO43900, 67 interactors
STRINGi9606.ENSP00000470248

PTM databases

iPTMnetiO43900
PhosphoSitePlusiO43900

Polymorphism and mutation databases

BioMutaiPRICKLE3

Proteomic databases

EPDiO43900
jPOSTiO43900
MassIVEiO43900
MaxQBiO43900
PaxDbiO43900
PeptideAtlasiO43900
PRIDEiO43900
ProteomicsDBi49223 [O43900-1]
6945

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
404 104 antibodies

The DNASU plasmid repository

More...
DNASUi
4007

Genome annotation databases

EnsembliENST00000599218; ENSP00000470248; ENSG00000012211 [O43900-1]
GeneIDi4007
KEGGihsa:4007
UCSCiuc004dmy.2 human [O43900-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4007
DisGeNETi4007

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PRICKLE3
HGNCiHGNC:6645 PRICKLE3
HPAiENSG00000012211 Low tissue specificity
MIMi300111 gene
neXtProtiNX_O43900
OpenTargetsiENSG00000012211
PharmGKBiPA162400060

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1704 Eukaryota
ENOG410XP0W LUCA
GeneTreeiENSGT00940000153629
HOGENOMiCLU_008937_8_1_1
InParanoidiO43900
KOiK04511
OMAiCTCYEAR
PhylomeDBiO43900
TreeFamiTF313265

Enzyme and pathway databases

SignaLinkiO43900

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PRICKLE3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4007
PharosiO43900 Tdark

Protein Ontology

More...
PROi
PR:O43900
RNActiO43900 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000012211 Expressed in ectocervix and 92 other tissues
ExpressionAtlasiO43900 baseline and differential
GenevisibleiO43900 HS

Family and domain databases

CDDicd09415 LIM1_Prickle, 1 hit
cd09418 LIM2_Prickle, 1 hit
cd09420 LIM3_Prickle, 1 hit
cd09827 PET_Prickle, 1 hit
InterProiView protein in InterPro
IPR033725 LIM1_prickle
IPR033726 LIM2_prickle
IPR033727 LIM3_prickle
IPR010442 PET_domain
IPR033723 PET_prickle
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 3 hits
PF06297 PET, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 3 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS51303 PET, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRIC3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43900
Secondary accession number(s): B7Z8F2, O76007, Q53XR5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: August 2, 2002
Last modified: April 22, 2020
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again