Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prickle planar cell polarity protein 3

Gene

PRICKLE3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the planar cell polarity (PCP) pathway that is essential for the polarization of epithelial cells during morphogenetic processes, including gastrulation and neurulation (By similarity). PCP is maintained by two molecular modules, the global and the core modules, PRICKLE3 being part of the core module (By similarity). Distinct complexes of the core module segregate to opposite sides of the cell, where they interact with the opposite complex in the neighboring cell at or near the adherents junctions (By similarity). Involved in the organization of the basal body (By similarity). Involved in cilia growth and positioning (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLinkiO43900

Names & Taxonomyi

Protein namesi
Recommended name:
Prickle planar cell polarity protein 3Imported
Alternative name(s):
LIM domain only protein 6
Short name:
LMO-6
Prickle-like protein 3
Short name:
Pk3Curated
Triple LIM domain protein 6
Gene namesi
Name:PRICKLE3Imported
Synonyms:LMO6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000012211.12
HGNCiHGNC:6645 PRICKLE3
MIMi300111 gene
neXtProtiNX_O43900

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000012211
PharmGKBiPA162400060

Polymorphism and mutation databases

BioMutaiPRICKLE3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758221 – 615Prickle planar cell polarity protein 3Add BLAST615

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei475PhosphoserineCombined sources1
Modified residuei491PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43900
MaxQBiO43900
PaxDbiO43900
PeptideAtlasiO43900
PRIDEiO43900
ProteomicsDBi49223

PTM databases

iPTMnetiO43900
PhosphoSitePlusiO43900

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiENSG00000012211 Expressed in 93 organ(s), highest expression level in ectocervix
CleanExiHS_PRICKLE3
ExpressionAtlasiO43900 baseline and differential
GenevisibleiO43900 HS

Organism-specific databases

HPAiHPA000998
HPA001442

Interactioni

Subunit structurei

Interacts with VANGL2 via its C-terminus (By similarity). The VANGL2-dependent membrane recruitment of PRICKLE3 is a prerequisite for its polarization (By similarity). Interacts with WTIP. WTIP is involved in the recruitment of PRICKLE3 to the basal body (By similarity).By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi110192, 70 interactors
IntActiO43900, 24 interactors
STRINGi9606.ENSP00000365494

Structurei

3D structure databases

ProteinModelPortaliO43900
SMRiO43900
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini74 – 182PETPROSITE-ProRule annotationAdd BLAST109
Domaini184 – 249LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST66
Domaini250 – 309LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini310 – 373LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST64

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi150 – 153Poly-Glu4
Compositional biasi513 – 522Poly-His10
Compositional biasi544 – 557Poly-SerAdd BLAST14

Sequence similaritiesi

Belongs to the prickle / espinas / testin family.Curated

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1704 Eukaryota
ENOG410XP0W LUCA
GeneTreeiENSGT00550000074438
HOGENOMiHOG000115694
HOVERGENiHBG106338
InParanoidiO43900
KOiK04511
OMAiDKNCIVA
OrthoDBiEOG091G07C5
PhylomeDBiO43900
TreeFamiTF313265

Family and domain databases

CDDicd09415 LIM1_Prickle, 1 hit
cd09418 LIM2_Prickle, 1 hit
cd09420 LIM3_Prickle, 1 hit
cd09827 PET_Prickle, 1 hit
InterProiView protein in InterPro
IPR033725 LIM1_prickle
IPR033726 LIM2_prickle
IPR033727 LIM3_prickle
IPR010442 PET_domain
IPR033723 PET_prickle
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 3 hits
PF06297 PET, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 3 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS51303 PET, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43900-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFARGSRRRR SGRAPPEAED PDRGQPCNSC REQCPGFLLH GWRKICQHCK
60 70 80 90 100
CPREEHAVHA VPVDLERIMC RLISDFQRHS ISDDDSGCAS EEYAWVPPGL
110 120 130 140 150
KPEQVYQFFS CLPEDKVPYV NSPGEKYRIK QLLHQLPPHD SEAQYCTALE
160 170 180 190 200
EEEKKELRAF SQQRKRENLG RGIVRIFPVT ITGAICEECG KQIGGGDIAV
210 220 230 240 250
FASRAGLGAC WHPQCFVCTT CQELLVDLIY FYHVGKVYCG RHHAECLRPR
260 270 280 290 300
CQACDEIIFS PECTEAEGRH WHMDHFCCFE CEASLGGQRY VMRQSRPHCC
310 320 330 340 350
ACYEARHAEY CDGCGEHIGL DQGQMAYEGQ HWHASDRCFC CSRCGRALLG
360 370 380 390 400
RPFLPRRGLI FCSRACSLGS EPTAPGPSRR SWSAGPVTAP LAASTASFSA
410 420 430 440 450
VKGASETTTK GTSTELAPAT GPEEPSRFLR GAPHRHSMPE LGLRSVPEPP
460 470 480 490 500
PESPGQPNLR PDDSAFGRQS TPRVSFRDPL VSEGGPRRTL SAPPAQRRRP
510 520 530 540 550
RSPPPRAPSR RRHHHHNHHH HHNRHPSRRR HYQCDAGSGS DSESCSSSPS
560 570 580 590 600
SSSSESSEDD GFFLGERIPL PPHLCRPMPA QDTAMETFNS PSLSLPRDSR
610
AGMPRQARDK NCIVA
Length:615
Mass (Da):68,609
Last modified:August 2, 2002 - v2
Checksum:iCD024365C072B052
GO
Isoform 2 (identifier: O43900-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.
     106-142: YQFFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDSE → TRGQPSTLAVQWVHTNAHTHTHTQ

Note: No experimental confirmation available.
Show »
Length:534
Mass (Da):59,097
Checksum:i7C2E745AEE1897E8
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y413H0Y413_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
547Annotation score:
H7BZP7H7BZP7_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
251Annotation score:
A0A0A0MRT7A0A0A0MRT7_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
114Annotation score:
F5H4N2F5H4N2_HUMAN
Prickle planar cell polarity protei...
PRICKLE3
98Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti185I → S in AAB92357 (PubMed:9344658).Curated1
Sequence conflicti370 – 509Missing in AAB92357 (PubMed:9344658).CuratedAdd BLAST140

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050169343R → C. Corresponds to variant dbSNP:rs7065449Ensembl.1
Natural variantiVAR_036188558E → D in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0565681 – 68Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_056569106 – 142YQFFS…PHDSE → TRGQPSTLAVQWVHTNAHTH THTQ in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011654 mRNA Translation: CAA09726.1
BT007423 mRNA Translation: AAP36091.1
AK303308 mRNA Translation: BAH13938.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50686.1
BC002468 mRNA Translation: AAH02468.1
BC016856 mRNA Translation: AAH16856.1
U93305 Genomic DNA Translation: AAB92357.1
CCDSiCCDS14320.1 [O43900-1]
RefSeqiNP_006141.2, NM_006150.4 [O43900-1]
UniGeneiHs.732712

Genome annotation databases

EnsembliENST00000599218; ENSP00000470248; ENSG00000012211 [O43900-1]
GeneIDi4007
KEGGihsa:4007
UCSCiuc004dmy.2 human [O43900-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ011654 mRNA Translation: CAA09726.1
BT007423 mRNA Translation: AAP36091.1
AK303308 mRNA Translation: BAH13938.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50686.1
BC002468 mRNA Translation: AAH02468.1
BC016856 mRNA Translation: AAH16856.1
U93305 Genomic DNA Translation: AAB92357.1
CCDSiCCDS14320.1 [O43900-1]
RefSeqiNP_006141.2, NM_006150.4 [O43900-1]
UniGeneiHs.732712

3D structure databases

ProteinModelPortaliO43900
SMRiO43900
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110192, 70 interactors
IntActiO43900, 24 interactors
STRINGi9606.ENSP00000365494

PTM databases

iPTMnetiO43900
PhosphoSitePlusiO43900

Polymorphism and mutation databases

BioMutaiPRICKLE3

Proteomic databases

EPDiO43900
MaxQBiO43900
PaxDbiO43900
PeptideAtlasiO43900
PRIDEiO43900
ProteomicsDBi49223

Protocols and materials databases

DNASUi4007
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000599218; ENSP00000470248; ENSG00000012211 [O43900-1]
GeneIDi4007
KEGGihsa:4007
UCSCiuc004dmy.2 human [O43900-1]

Organism-specific databases

CTDi4007
EuPathDBiHostDB:ENSG00000012211.12
GeneCardsiPRICKLE3
HGNCiHGNC:6645 PRICKLE3
HPAiHPA000998
HPA001442
MIMi300111 gene
neXtProtiNX_O43900
OpenTargetsiENSG00000012211
PharmGKBiPA162400060
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1704 Eukaryota
ENOG410XP0W LUCA
GeneTreeiENSGT00550000074438
HOGENOMiHOG000115694
HOVERGENiHBG106338
InParanoidiO43900
KOiK04511
OMAiDKNCIVA
OrthoDBiEOG091G07C5
PhylomeDBiO43900
TreeFamiTF313265

Enzyme and pathway databases

SignaLinkiO43900

Miscellaneous databases

ChiTaRSiPRICKLE3 human
GenomeRNAii4007
PROiPR:O43900
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000012211 Expressed in 93 organ(s), highest expression level in ectocervix
CleanExiHS_PRICKLE3
ExpressionAtlasiO43900 baseline and differential
GenevisibleiO43900 HS

Family and domain databases

CDDicd09415 LIM1_Prickle, 1 hit
cd09418 LIM2_Prickle, 1 hit
cd09420 LIM3_Prickle, 1 hit
cd09827 PET_Prickle, 1 hit
InterProiView protein in InterPro
IPR033725 LIM1_prickle
IPR033726 LIM2_prickle
IPR033727 LIM3_prickle
IPR010442 PET_domain
IPR033723 PET_prickle
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 3 hits
PF06297 PET, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 3 hits
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS51303 PET, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPRIC3_HUMAN
AccessioniPrimary (citable) accession number: O43900
Secondary accession number(s): B7Z8F2, O76007, Q53XR5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: August 2, 2002
Last modified: September 12, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again