Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nardilysin

Gene

NRDC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Catalytic activityi

Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi233ZincPROSITE-ProRule annotation1
Active sitei236Proton acceptorPROSITE-ProRule annotation1
Metal bindingi237ZincPROSITE-ProRule annotation1
Metal bindingi314ZincPROSITE-ProRule annotation1

GO - Molecular functioni

  • epidermal growth factor binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDAi3.4.24.61 2681
SignaLinkiO43847

Protein family/group databases

MEROPSiM16.005

Names & Taxonomyi

Protein namesi
Recommended name:
Nardilysin (EC:3.4.24.61)
Alternative name(s):
N-arginine dibasic convertase
Short name:
NRD convertase
Short name:
NRD-C
Nardilysin convertaseImported
Gene namesi
Name:NRDCImported
Synonyms:NRD1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000078618.19
HGNCiHGNC:7995 NRDC
MIMi602651 gene
neXtProtiNX_O43847

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi4898
OpenTargetsiENSG00000078618
PharmGKBiPA31774

Polymorphism and mutation databases

BioMutaiNRD1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000002675521 – 1151NardilysinAdd BLAST1131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei86PhosphoserineCombined sources1
Modified residuei94PhosphoserineCombined sources1
Modified residuei96PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43847
MaxQBiO43847
PaxDbiO43847
PeptideAtlasiO43847
PRIDEiO43847
ProteomicsDBi49200
49201 [O43847-2]

PTM databases

iPTMnetiO43847
PhosphoSitePlusiO43847

Expressioni

Tissue specificityi

Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.

Gene expression databases

BgeeiENSG00000078618 Expressed in 233 organ(s), highest expression level in quadriceps femoris
CleanExiHS_NRD1
ExpressionAtlasiO43847 baseline and differential
GenevisibleiO43847 HS

Organism-specific databases

HPAiHPA053661

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TP53P046376EBI-2371631,EBI-366083

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110954, 85 interactors
IntActiO43847, 30 interactors
MINTiO43847
STRINGi9606.ENSP00000346890

Structurei

3D structure databases

ProteinModelPortaliO43847
SMRiO43847
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi142 – 201Asp/Glu-rich (highly acidic)Add BLAST60
Compositional biasi144 – 153Poly-Glu10

Sequence similaritiesi

Belongs to the peptidase M16 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0959 Eukaryota
COG1025 LUCA
GeneTreeiENSGT00530000063327
HOVERGENiHBG006530
InParanoidiO43847
KOiK01411
PhylomeDBiO43847

Family and domain databases

InterProiView protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C
IPR032632 Peptidase_M16_M
PfamiView protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 2 hits
PF16187 Peptidase_M16_M, 1 hit
SUPFAMiSSF63411 SSF63411, 4 hits
PROSITEiView protein in PROSITE
PS00143 INSULINASE, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43847-1) [UniParc]FASTAAdd to basket
Also known as: NRD1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRRVTVAAV CATRRKLCEA GRELAALWGI ETRGRCEDSA AARPFPILAM
60 70 80 90 100
PGRNKAKSTC SCPDLQPNGQ DLGENSRVAR LGADESEEEG RRGSLSNAGD
110 120 130 140 150
PEIVKSPSDP KQYRYIKLQN GLQALLISDL SNMEGKTGNT TDDEEEEEVE
160 170 180 190 200
EEEEDDDEDS GAEIEDDDEE GFDDEDEFDD EHDDDLDTED NELEELEERA
210 220 230 240 250
EARKKTTEKQ SAAALCVGVG SFADPDDLPG LAHFLEHMVF MGSLKYPDEN
260 270 280 290 300
GFDAFLKKHG GSDNASTDCE RTVFQFDVQR KYFKEALDRW AQFFIHPLMI
310 320 330 340 350
RDAIDREVEA VDSEYQLARP SDANRKEMLF GSLARPGHPM GKFFWGNAET
360 370 380 390 400
LKHEPRKNNI DTHARLREFW MRYYSSHYMT LVVQSKETLD TLEKWVTEIF
410 420 430 440 450
SQIPNNGLPR PNFGHLTDPF DTPAFNKLYR VVPIRKIHAL TITWALPPQQ
460 470 480 490 500
QHYRVKPLHY ISWLVGHEGK GSILSFLRKK CWALALFGGN GETGFEQNST
510 520 530 540 550
YSVFSISITL TDEGYEHFYE VAYTVFQYLK MLQKLGPEKR IFEEIRKIED
560 570 580 590 600
NEFHYQEQTD PVEYVENMCE NMQLYPLQDI LTGDQLLFEY KPEVIGEALN
610 620 630 640 650
QLVPQKANLV LLSGANEGKC DLKEKWFGTQ YSIEDIENSW AELWNSNFEL
660 670 680 690 700
NPDLHLPAEN KYIATDFTLK AFDCPETEYP VKIVNTPQGC LWYKKDNKFK
710 720 730 740 750
IPKAYIRFHL ISPLIQKSAA NVVLFDIFVN ILTHNLAEPA YEADVAQLEY
760 770 780 790 800
KLVAGEHGLI IRVKGFNHKL PLLFQLIIDY LAEFNSTPAV FTMITEQLKK
810 820 830 840 850
TYFNILIKPE TLAKDVRLLI LEYARWSMID KYQALMDGLS LESLLSFVKE
860 870 880 890 900
FKSQLFVEGL VQGNVTSTES MDFLKYVVDK LNFKPLEQEM PVQFQVVELP
910 920 930 940 950
SGHHLCKVKA LNKGDANSEV TVYYQSGTRS LREYTLMELL VMHMEEPCFD
960 970 980 990 1000
FLRTKQTLGY HVYPTCRNTS GILGFSVTVG TQATKYNSEV VDKKIEEFLS
1010 1020 1030 1040 1050
SFEEKIENLT EEAFNTQVTA LIKLKECEDT HLGEEVDRNW NEVVTQQYLF
1060 1070 1080 1090 1100
DRLAHEIEAL KSFSKSDLVN WFKAHRGPGS KMLSVHVVGY GKYELEEDGT
1110 1120 1130 1140 1150
PSSEDSNSSC EVMQLTYLPT SPLLADCIIP ITDIRAFTTT LNLLPYHKIV

K
Length:1,151
Mass (Da):131,701
Last modified:October 10, 2018 - v3
Checksum:iCD03BF258AF65122
GO
Isoform 2 (identifier: O43847-2) [UniParc]FASTAAdd to basket
Also known as: NRD2

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: Q → QQLQSLFLLWSKLTDRLWFKSTYSKMSSTLLVETRNLYGVVGAESRSAPVQHLAGWQAEEQQGETDTVL

Show »
Length:1,219
Mass (Da):139,413
Checksum:i4E41D50112DB4070
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V1R5G3V1R5_HUMAN
Nardilysin
NRDC NRD1, hCG_40292
1,087Annotation score:
F5H7V1F5H7V1_HUMAN
Nardilysin
NRDC
949Annotation score:
B1AKJ5B1AKJ5_HUMAN
Nardilysin
NRDC NRD1, hCG_40292
1,219Annotation score:
H0Y5G9H0Y5G9_HUMAN
Nardilysin
NRDC
538Annotation score:

Sequence cautioni

The sequence AAC39597 differs from that shown. Reason: Frameshift at position 1126.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23 – 24EL → DV in CAA63698 (PubMed:9581555).Curated2
Sequence conflicti23 – 24EL → DV in CAA63694 (PubMed:9581555).Curated2
Sequence conflicti527Q → L in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti527Q → L in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti641A → G in AAC39597 (PubMed:9479496).Curated1
Sequence conflicti753V → A in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti753V → A in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti1087V → A in AAC39597 (PubMed:9479496).Curated1
Sequence conflicti1100T → S in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti1100T → S in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti1126D → S in AAC39597 (PubMed:9479496).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_080827154Missing 1 Publication1
Natural variantiVAR_057058832Y → S. Corresponds to variant dbSNP:rs34957144Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007114210Q → QQLQSLFLLWSKLTDRLWFK STYSKMSSTLLVETRNLYGV VGAESRSAPVQHLAGWQAEE QQGETDTVL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93207 mRNA Translation: CAA63694.1
X93209 mRNA Translation: CAA63698.1
U64898 mRNA Translation: AAC39597.1 Frameshift.
AL050343 Genomic DNA No translation available.
AL589663 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06809.1
BC008775 mRNA Translation: AAH08775.1
AJ000350 Genomic DNA Translation: CAA04025.1
RefSeqiNP_001095132.1, NM_001101662.1
NP_001229290.1, NM_001242361.1
NP_002516.2, NM_002525.2
UniGeneiHs.584782

Genome annotation databases

EnsembliENST00000352171; ENSP00000262679; ENSG00000078618 [O43847-1]
ENST00000354831; ENSP00000346890; ENSG00000078618 [O43847-2]
GeneIDi4898
KEGGihsa:4898
UCSCiuc001ctd.5 human [O43847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93207 mRNA Translation: CAA63694.1
X93209 mRNA Translation: CAA63698.1
U64898 mRNA Translation: AAC39597.1 Frameshift.
AL050343 Genomic DNA No translation available.
AL589663 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06809.1
BC008775 mRNA Translation: AAH08775.1
AJ000350 Genomic DNA Translation: CAA04025.1
RefSeqiNP_001095132.1, NM_001101662.1
NP_001229290.1, NM_001242361.1
NP_002516.2, NM_002525.2
UniGeneiHs.584782

3D structure databases

ProteinModelPortaliO43847
SMRiO43847
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110954, 85 interactors
IntActiO43847, 30 interactors
MINTiO43847
STRINGi9606.ENSP00000346890

Protein family/group databases

MEROPSiM16.005

PTM databases

iPTMnetiO43847
PhosphoSitePlusiO43847

Polymorphism and mutation databases

BioMutaiNRD1

Proteomic databases

EPDiO43847
MaxQBiO43847
PaxDbiO43847
PeptideAtlasiO43847
PRIDEiO43847
ProteomicsDBi49200
49201 [O43847-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000352171; ENSP00000262679; ENSG00000078618 [O43847-1]
ENST00000354831; ENSP00000346890; ENSG00000078618 [O43847-2]
GeneIDi4898
KEGGihsa:4898
UCSCiuc001ctd.5 human [O43847-1]

Organism-specific databases

CTDi4898
DisGeNETi4898
EuPathDBiHostDB:ENSG00000078618.19
GeneCardsiNRDC
H-InvDBiHIX0000576
HGNCiHGNC:7995 NRDC
HPAiHPA053661
MIMi602651 gene
neXtProtiNX_O43847
OpenTargetsiENSG00000078618
PharmGKBiPA31774
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0959 Eukaryota
COG1025 LUCA
GeneTreeiENSGT00530000063327
HOVERGENiHBG006530
InParanoidiO43847
KOiK01411
PhylomeDBiO43847

Enzyme and pathway databases

BRENDAi3.4.24.61 2681
SignaLinkiO43847

Miscellaneous databases

ChiTaRSiNRDC human
GeneWikiiNRD1
GenomeRNAii4898
PROiPR:O43847
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000078618 Expressed in 233 organ(s), highest expression level in quadriceps femoris
CleanExiHS_NRD1
ExpressionAtlasiO43847 baseline and differential
GenevisibleiO43847 HS

Family and domain databases

InterProiView protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C
IPR032632 Peptidase_M16_M
PfamiView protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 2 hits
PF16187 Peptidase_M16_M, 1 hit
SUPFAMiSSF63411 SSF63411, 4 hits
PROSITEiView protein in PROSITE
PS00143 INSULINASE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNRDC_HUMAN
AccessioniPrimary (citable) accession number: O43847
Secondary accession number(s): A6NI41
, O15241, O15242, Q5VUL0, Q96HB2, Q9NU57
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: October 10, 2018
Last modified: November 7, 2018
This is version 163 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again