Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nardilysin

Gene

NRDC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys. EC:3.4.24.61

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi233ZincPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei236Proton acceptorPROSITE-ProRule annotation1
Metal bindingi237ZincPROSITE-ProRule annotation1
Metal bindingi314ZincPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • epidermal growth factor binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.24.61 2681

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
O43847

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M16.005

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nardilysin (EC:3.4.24.61)
Alternative name(s):
N-arginine dibasic convertase
Short name:
NRD convertase
Short name:
NRD-C
Nardilysin convertaseImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRDCImported
Synonyms:NRD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000078618.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7995 NRDC

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602651 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43847

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4898

Open Targets

More...
OpenTargetsi
ENSG00000078618

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31774

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NRDC

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Sequence analysisAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002675521 – 1151NardilysinAdd BLAST1131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei86PhosphoserineCombined sources1
Modified residuei94PhosphoserineCombined sources1
Modified residuei96PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O43847

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43847

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43847

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43847

PeptideAtlas

More...
PeptideAtlasi
O43847

PRoteomics IDEntifications database

More...
PRIDEi
O43847

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49200
49201 [O43847-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43847

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43847

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000078618 Expressed in 233 organ(s), highest expression level in quadriceps femoris

CleanEx database of gene expression profiles

More...
CleanExi
HS_NRD1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43847 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43847 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA053661

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TP53P046376EBI-2371631,EBI-366083

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110954, 86 interactors

Protein interaction database and analysis system

More...
IntActi
O43847, 30 interactors

Molecular INTeraction database

More...
MINTi
O43847

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000346890

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O43847

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi142 – 201Asp/Glu-rich (highly acidic)Add BLAST60
Compositional biasi144 – 153Poly-Glu10

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M16 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0959 Eukaryota
COG1025 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155026

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006530

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43847

KEGG Orthology (KO)

More...
KOi
K01411

Database of Orthologous Groups

More...
OrthoDBi
1008844at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43847

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C
IPR032632 Peptidase_M16_M

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 2 hits
PF16187 Peptidase_M16_M, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63411 SSF63411, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00143 INSULINASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43847-1) [UniParc]FASTAAdd to basket
Also known as: NRD1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRRVTVAAV CATRRKLCEA GRELAALWGI ETRGRCEDSA AARPFPILAM
60 70 80 90 100
PGRNKAKSTC SCPDLQPNGQ DLGENSRVAR LGADESEEEG RRGSLSNAGD
110 120 130 140 150
PEIVKSPSDP KQYRYIKLQN GLQALLISDL SNMEGKTGNT TDDEEEEEVE
160 170 180 190 200
EEEEDDDEDS GAEIEDDDEE GFDDEDEFDD EHDDDLDTED NELEELEERA
210 220 230 240 250
EARKKTTEKQ SAAALCVGVG SFADPDDLPG LAHFLEHMVF MGSLKYPDEN
260 270 280 290 300
GFDAFLKKHG GSDNASTDCE RTVFQFDVQR KYFKEALDRW AQFFIHPLMI
310 320 330 340 350
RDAIDREVEA VDSEYQLARP SDANRKEMLF GSLARPGHPM GKFFWGNAET
360 370 380 390 400
LKHEPRKNNI DTHARLREFW MRYYSSHYMT LVVQSKETLD TLEKWVTEIF
410 420 430 440 450
SQIPNNGLPR PNFGHLTDPF DTPAFNKLYR VVPIRKIHAL TITWALPPQQ
460 470 480 490 500
QHYRVKPLHY ISWLVGHEGK GSILSFLRKK CWALALFGGN GETGFEQNST
510 520 530 540 550
YSVFSISITL TDEGYEHFYE VAYTVFQYLK MLQKLGPEKR IFEEIRKIED
560 570 580 590 600
NEFHYQEQTD PVEYVENMCE NMQLYPLQDI LTGDQLLFEY KPEVIGEALN
610 620 630 640 650
QLVPQKANLV LLSGANEGKC DLKEKWFGTQ YSIEDIENSW AELWNSNFEL
660 670 680 690 700
NPDLHLPAEN KYIATDFTLK AFDCPETEYP VKIVNTPQGC LWYKKDNKFK
710 720 730 740 750
IPKAYIRFHL ISPLIQKSAA NVVLFDIFVN ILTHNLAEPA YEADVAQLEY
760 770 780 790 800
KLVAGEHGLI IRVKGFNHKL PLLFQLIIDY LAEFNSTPAV FTMITEQLKK
810 820 830 840 850
TYFNILIKPE TLAKDVRLLI LEYARWSMID KYQALMDGLS LESLLSFVKE
860 870 880 890 900
FKSQLFVEGL VQGNVTSTES MDFLKYVVDK LNFKPLEQEM PVQFQVVELP
910 920 930 940 950
SGHHLCKVKA LNKGDANSEV TVYYQSGTRS LREYTLMELL VMHMEEPCFD
960 970 980 990 1000
FLRTKQTLGY HVYPTCRNTS GILGFSVTVG TQATKYNSEV VDKKIEEFLS
1010 1020 1030 1040 1050
SFEEKIENLT EEAFNTQVTA LIKLKECEDT HLGEEVDRNW NEVVTQQYLF
1060 1070 1080 1090 1100
DRLAHEIEAL KSFSKSDLVN WFKAHRGPGS KMLSVHVVGY GKYELEEDGT
1110 1120 1130 1140 1150
PSSEDSNSSC EVMQLTYLPT SPLLADCIIP ITDIRAFTTT LNLLPYHKIV

K
Length:1,151
Mass (Da):131,701
Last modified:October 10, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCD03BF258AF65122
GO
Isoform 2 (identifier: O43847-2) [UniParc]FASTAAdd to basket
Also known as: NRD2

The sequence of this isoform differs from the canonical sequence as follows:
     210-210: Q → QQLQSLFLLWSKLTDRLWFKSTYSKMSSTLLVETRNLYGVVGAESRSAPVQHLAGWQAEEQQGETDTVL

Show »
Length:1,219
Mass (Da):139,413
Checksum:i4E41D50112DB4070
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V1R5G3V1R5_HUMAN
Nardilysin
NRDC NRD1, hCG_40292
1,087Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7V1F5H7V1_HUMAN
Nardilysin
NRDC
949Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AKJ5B1AKJ5_HUMAN
Nardilysin
NRDC NRD1, hCG_40292
1,219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y5G9H0Y5G9_HUMAN
Nardilysin
NRDC
538Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC39597 differs from that shown. Reason: Frameshift at position 1126.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti23 – 24EL → DV in CAA63698 (PubMed:9581555).Curated2
Sequence conflicti23 – 24EL → DV in CAA63694 (PubMed:9581555).Curated2
Sequence conflicti527Q → L in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti527Q → L in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti641A → G in AAC39597 (PubMed:9479496).Curated1
Sequence conflicti753V → A in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti753V → A in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti1087V → A in AAC39597 (PubMed:9479496).Curated1
Sequence conflicti1100T → S in CAA63698 (PubMed:9581555).Curated1
Sequence conflicti1100T → S in CAA63694 (PubMed:9581555).Curated1
Sequence conflicti1126D → S in AAC39597 (PubMed:9479496).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_080827154Missing 1 Publication1
Natural variantiVAR_057058832Y → S. Corresponds to variant dbSNP:rs34957144Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007114210Q → QQLQSLFLLWSKLTDRLWFK STYSKMSSTLLVETRNLYGV VGAESRSAPVQHLAGWQAEE QQGETDTVL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X93207 mRNA Translation: CAA63694.1
X93209 mRNA Translation: CAA63698.1
U64898 mRNA Translation: AAC39597.1 Frameshift.
AL050343 Genomic DNA No translation available.
AL589663 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06809.1
BC008775 mRNA Translation: AAH08775.1
AJ000350 Genomic DNA Translation: CAA04025.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41335.1 [O43847-1]
CCDS559.1 [O43847-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001095132.1, NM_001101662.1 [O43847-1]
NP_001229290.1, NM_001242361.1
NP_002516.2, NM_002525.2 [O43847-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.584782

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000352171; ENSP00000262679; ENSG00000078618 [O43847-1]
ENST00000354831; ENSP00000346890; ENSG00000078618 [O43847-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4898

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4898

UCSC genome browser

More...
UCSCi
uc001ctd.5 human [O43847-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93207 mRNA Translation: CAA63694.1
X93209 mRNA Translation: CAA63698.1
U64898 mRNA Translation: AAC39597.1 Frameshift.
AL050343 Genomic DNA No translation available.
AL589663 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06809.1
BC008775 mRNA Translation: AAH08775.1
AJ000350 Genomic DNA Translation: CAA04025.1
CCDSiCCDS41335.1 [O43847-1]
CCDS559.1 [O43847-2]
RefSeqiNP_001095132.1, NM_001101662.1 [O43847-1]
NP_001229290.1, NM_001242361.1
NP_002516.2, NM_002525.2 [O43847-2]
UniGeneiHs.584782

3D structure databases

ProteinModelPortaliO43847
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110954, 86 interactors
IntActiO43847, 30 interactors
MINTiO43847
STRINGi9606.ENSP00000346890

Protein family/group databases

MEROPSiM16.005

PTM databases

iPTMnetiO43847
PhosphoSitePlusiO43847

Polymorphism and mutation databases

BioMutaiNRDC

Proteomic databases

EPDiO43847
jPOSTiO43847
MaxQBiO43847
PaxDbiO43847
PeptideAtlasiO43847
PRIDEiO43847
ProteomicsDBi49200
49201 [O43847-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000352171; ENSP00000262679; ENSG00000078618 [O43847-1]
ENST00000354831; ENSP00000346890; ENSG00000078618 [O43847-2]
GeneIDi4898
KEGGihsa:4898
UCSCiuc001ctd.5 human [O43847-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4898
DisGeNETi4898
EuPathDBiHostDB:ENSG00000078618.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NRDC

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0000576
HGNCiHGNC:7995 NRDC
HPAiHPA053661
MIMi602651 gene
neXtProtiNX_O43847
OpenTargetsiENSG00000078618
PharmGKBiPA31774

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0959 Eukaryota
COG1025 LUCA
GeneTreeiENSGT00940000155026
HOVERGENiHBG006530
InParanoidiO43847
KOiK01411
OrthoDBi1008844at2759
PhylomeDBiO43847

Enzyme and pathway databases

BRENDAi3.4.24.61 2681
SignaLinkiO43847

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NRDC human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NRD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4898

Protein Ontology

More...
PROi
PR:O43847

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000078618 Expressed in 233 organ(s), highest expression level in quadriceps femoris
CleanExiHS_NRD1
ExpressionAtlasiO43847 baseline and differential
GenevisibleiO43847 HS

Family and domain databases

InterProiView protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C
IPR032632 Peptidase_M16_M
PfamiView protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 2 hits
PF16187 Peptidase_M16_M, 1 hit
SUPFAMiSSF63411 SSF63411, 4 hits
PROSITEiView protein in PROSITE
PS00143 INSULINASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRDC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43847
Secondary accession number(s): A6NI41
, O15241, O15242, Q5VUL0, Q96HB2, Q9NU57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: October 10, 2018
Last modified: January 16, 2019
This is version 165 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again