Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43776 (SYNC_HUMAN)

Entry version 186 (10 Feb 2021)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Asparagine--tRNA ligase, cytoplasmic

Gene

NARS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the attachment of asparagine to tRNA(Asn) in a two-step reaction: asparagine is first activated by ATP to form Asn-AMP and then transferred to the acceptor end of tRNA(Asn) (PubMed:9421509). In addition to its essential role in protein synthesis, acts as a signaling molecule that induced migration of CCR3-expressing cells (PubMed:30171954, PubMed:12235211).3 Publications

Miscellaneous

Autoantibodies to NARS1, are often detected in sera from patients with interstitial lung disease (ILD).1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAminoacyl-tRNA synthetase, Ligase
Biological processProtein biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		6.1.1.22, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43776

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-379716, Cytosolic tRNA aminoacylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Asparagine--tRNA ligase, cytoplasmic (EC:6.1.1.221 Publication)
Alternative name(s):
Asparaginyl-tRNA synthetase
Short name:
AsnRS
Asparaginyl-tRNA synthetase 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NARS1Imported
Synonyms:NARS, NRS1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7643, NARS1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		108410, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43776

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000134440.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		4677

Open Targets

More...OpenTargetsi		ENSG00000134440

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31447

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43776, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB00174, Asparagine

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NARS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001764961 – 548Asparagine--tRNA ligase, cytoplasmicAdd BLAST548

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei61PhosphoserineCombined sources1
Modified residuei244N6-acetyllysineCombined sources1
Modified residuei482PhosphoserineBy similarity1
Modified residuei490N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43776

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43776

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43776

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43776

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43776

PeptideAtlas

More...PeptideAtlasi		O43776

PRoteomics IDEntifications database

More...PRIDEi		O43776

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4098
49167 [O43776-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43776

MetOSite database of methionine sulfoxide sites

More...MetOSitei		O43776

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43776

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O43776

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000134440, Expressed in metanephros and 243 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43776, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43776, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000134440, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110758, 86 interactors

Protein interaction database and analysis system

More...IntActi		O43776, 30 interactors

Molecular INTeraction database

More...MINTi		O43776

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000256854

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43776, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1548
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43776

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal domain (1-77) recruits and activates specific immune cells by interacting with CCR3-expressing cells.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class-II aminoacyl-tRNA synthetase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0555, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01010000222368

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_004553_2_10_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43776

Identification of Orthologs from Complete Genome Data

More...OMAi		HLAEYSH

Database of Orthologous Groups

More...OrthoDBi		1056670at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43776

TreeFam database of animal gene trees

More...TreeFami		TF105664

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004364, Aa-tRNA-synt_II
IPR006195, aa-tRNA-synth_II
IPR004522, Asn-tRNA-ligase
IPR002312, Asp/Asn-tRNA-synth_IIb
IPR012340, NA-bd_OB-fold
IPR004365, NA-bd_OB_tRNA

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00152, tRNA-synt_2, 1 hit
PF01336, tRNA_anti-codon, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01042, TRNASYNTHASP

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50249, SSF50249, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00457, asnS, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50862, AA_TRNA_LIGASE_II, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43776-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLAELYVSD REGSDATGDG TKEKPFKTGL KALMTVGKEP FPTIYVDSQK 
        60         70         80         90        100
ENERWNVISK SQLKNIKKMW HREQMKSESR EKKEAEDSLR REKNLEEAKK 
       110        120        130        140        150
ITIKNDPSLP EPKCVKIGAL EGYRGQRVKV FGWVHRLRRQ GKNLMFLVLR 
       160        170        180        190        200
DGTGYLQCVL ADELCQCYNG VLLSTESSVA VYGMLNLTPK GKQAPGGHEL 
       210        220        230        240        250
SCDFWELIGL APAGGADNLI NEESDVDVQL NNRHMMIRGE NMSKILKARS 
       260        270        280        290        300
MVTRCFRDHF FDRGYYEVTP PTLVQTQVEG GATLFKLDYF GEEAFLTQSS 
       310        320        330        340        350
QLYLETCLPA LGDVFCIAQS YRAEQSRTRR HLAEYTHVEA ECPFLTFDDL 
       360        370        380        390        400
LNRLEDLVCD VVDRILKSPA GSIVHELNPN FQPPKRPFKR MNYSDAIVWL 
       410        420        430        440        450
KEHDVKKEDG TFYEFGEDIP EAPERLMTDT INEPILLCRF PVEIKSFYMQ 
       460        470        480        490        500
RCPEDSRLTE SVDVLMPNVG EIVGGSMRIF DSEEILAGYK REGIDPTPYY 
       510        520        530        540 
WYTDQRKYGT CPHGGYGLGL ERFLTWILNR YHIRDVCLYP RFVQRCTP
Length:548
Mass (Da):62,943
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCDD442C4E962CDDB
GO
Isoform 2 (identifier: O43776-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-173: GKNLMFLVLRDGTGYLQCVLADELCQCYNGVLL → VSVLQWSSLVHGEQCCSVWNAKSYPKGQAGSRW
     174-547: Missing.

Show »
Length:174
Mass (Da):20,033
Checksum:i594E9ED90ED09E4B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EPK2K7EPK2_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMQ6K7EMQ6_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQ35K7EQ35_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIU7K7EIU7_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJ19K7EJ19_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENF0K7ENF0_HUMAN
Asparagine--tRNA ligase, cytoplasmi...
NARS1
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti391M → V in BAD96555 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056201141 – 173GKNLM…NGVLL → VSVLQWSSLVHGEQCCSVWN AKSYPKGQAGSRW in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_056202174 – 547Missing in isoform 2. 1 PublicationAdd BLAST374

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ000334 mRNA Translation: CAA04008.1
D84273 mRNA Translation: BAA34600.1
AK294364 mRNA Translation: BAG57627.1
AC100847 Genomic DNA No translation available.
AK222835 mRNA Translation: BAD96555.1
BC001687 mRNA Translation: AAH01687.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32837.1 [O43776-1]

NCBI Reference Sequences

More...RefSeqi		NP_004530.1, NM_004539.3 [O43776-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000256854; ENSP00000256854; ENSG00000134440 [O43776-1]
ENST00000540592; ENSP00000442496; ENSG00000134440 [O43776-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4677

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4677

UCSC genome browser

More...UCSCi		uc002lgs.4, human [O43776-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ000334 mRNA Translation: CAA04008.1
D84273 mRNA Translation: BAA34600.1
AK294364 mRNA Translation: BAG57627.1
AC100847 Genomic DNA No translation available.
AK222835 mRNA Translation: BAD96555.1
BC001687 mRNA Translation: AAH01687.1
CCDSiCCDS32837.1 [O43776-1]
RefSeqiNP_004530.1, NM_004539.3 [O43776-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZYAX-ray1.65A/B4-77[»]
5XIXX-ray2.25A/B/C/D98-548[»]
SMRiO43776
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110758, 86 interactors
IntActiO43776, 30 interactors
MINTiO43776
STRINGi9606.ENSP00000256854

Chemistry databases

DrugBankiDB00174, Asparagine

PTM databases

iPTMnetiO43776
MetOSiteiO43776
PhosphoSitePlusiO43776
SwissPalmiO43776

Genetic variation databases

BioMutaiNARS

Proteomic databases

EPDiO43776
jPOSTiO43776
MassIVEiO43776
MaxQBiO43776
PaxDbiO43776
PeptideAtlasiO43776
PRIDEiO43776
ProteomicsDBi4098
49167 [O43776-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		O43776, 3 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		9706, 179 antibodies

Genome annotation databases

EnsembliENST00000256854; ENSP00000256854; ENSG00000134440 [O43776-1]
ENST00000540592; ENSP00000442496; ENSG00000134440 [O43776-2]
GeneIDi4677
KEGGihsa:4677
UCSCiuc002lgs.4, human [O43776-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4677
DisGeNETi4677

GeneCards: human genes, protein and diseases

More...GeneCardsi		NARS1
HGNCiHGNC:7643, NARS1
HPAiENSG00000134440, Low tissue specificity
MIMi108410, gene
neXtProtiNX_O43776
OpenTargetsiENSG00000134440
PharmGKBiPA31447
VEuPathDBiHostDB:ENSG00000134440.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0555, Eukaryota
GeneTreeiENSGT01010000222368
HOGENOMiCLU_004553_2_10_1
InParanoidiO43776
OMAiHLAEYSH
OrthoDBi1056670at2759
PhylomeDBiO43776
TreeFamiTF105664

Enzyme and pathway databases

BRENDAi6.1.1.22, 2681
PathwayCommonsiO43776
ReactomeiR-HSA-379716, Cytosolic tRNA aminoacylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4677, 766 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NARS, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NARS_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4677
PharosiO43776, Tbio

Protein Ontology

More...PROi		PR:O43776
RNActiO43776, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000134440, Expressed in metanephros and 243 other tissues
ExpressionAtlasiO43776, baseline and differential
GenevisibleiO43776, HS

Family and domain databases

InterProiView protein in InterPro
IPR004364, Aa-tRNA-synt_II
IPR006195, aa-tRNA-synth_II
IPR004522, Asn-tRNA-ligase
IPR002312, Asp/Asn-tRNA-synth_IIb
IPR012340, NA-bd_OB-fold
IPR004365, NA-bd_OB_tRNA
PfamiView protein in Pfam
PF00152, tRNA-synt_2, 1 hit
PF01336, tRNA_anti-codon, 1 hit
PRINTSiPR01042, TRNASYNTHASP
SUPFAMiSSF50249, SSF50249, 1 hit
TIGRFAMsiTIGR00457, asnS, 1 hit
PROSITEiView protein in PROSITE
PS50862, AA_TRNA_LIGASE_II, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYNC_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43776
Secondary accession number(s): B4DG16, Q53GU6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: June 1, 1998
Last modified: February 10, 2021
This is version 186 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  5. Aminoacyl-tRNA synthetases
    List of aminoacyl-tRNA synthetase entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again