Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - O43759 (SNG1_HUMAN)

Entry version 174 (23 Feb 2022)
Sequence version 2 (03 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Synaptogyrin-1

Gene

SYNGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity).

Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43759

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6798695, Neutrophil degranulation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O43759

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptogyrin-1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYNGR1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11498, SYNGR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603925, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43759

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000100321

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 23CytoplasmicBy similarityAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 71LumenalBy similarityAdd BLAST27
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 103CytoplasmicBy similarityAdd BLAST11
Transmembranei104 – 124HelicalSequence analysisAdd BLAST21
Topological domaini125 – 148LumenalBy similarityAdd BLAST24
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21
Topological domaini170 – 233CytoplasmicBy similarityAdd BLAST64

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9145

Open Targets

More...OpenTargetsi		ENSG00000100321

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36280

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43759, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SYNGR1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001839901 – 233Synaptogyrin-1Add BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43759

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43759

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43759

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43759

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43759

PeptideAtlas

More...PeptideAtlasi		O43759

PRoteomics IDEntifications database

More...PRIDEi		O43759

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		49150 [O43759-1]
49151 [O43759-2]
49152 [O43759-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		O43759-1 [O43759-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43759

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43759

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O43759

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000100321, Expressed in anterior cingulate cortex and 245 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43759, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43759, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000100321, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114592, 97 interactors

Protein interaction database and analysis system

More...IntActi		O43759, 33 interactors

Molecular INTeraction database

More...MINTi		O43759

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000332287

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43759, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 173MARVELPROSITE-ProRule annotationAdd BLAST154

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni194 – 233DisorderedSequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi213 – 233Polar residuesSequence analysisAdd BLAST21

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptogyrin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4016, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182935

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_079186_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43759

Identification of Orthologs from Complete Genome Data

More...OMAi		NEQYSAS

Database of Orthologous Groups

More...OrthoDBi		1549362at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43759

TreeFam database of animal gene trees

More...TreeFami		TF320995

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008253, Marvel
IPR016579, Synaptogyrin

The PANTHER Classification System

More...PANTHERi		PTHR10838, PTHR10838, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01284, MARVEL, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF011282, Synaptogyrin, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51225, MARVEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1A (identifier: O43759-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWLFSIVVF GSIVNEGYLN 
        60         70         80         90        100
SASEGEEFCI YNRNPNACSY GVAVGVLAFL TCLLYLALDV YFPQISSVKD 
       110        120        130        140        150
RKKAVLSDIG VSAFWAFLWF VGFCYLANQW QVSKPKDNPL NEGTDAARAA 
       160        170        180        190        200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV 
       210        220        230 
EPTGPDPAGM GGTYQQPANT FDTEPQGYQS QGY
Length:233
Mass (Da):25,456
Last modified:October 3, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8DE7000A46960213
GO
Isoform 1B (identifier: O43759-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:191
Mass (Da):21,038
Checksum:iB620694C3DAEF56C
GO
Isoform 1C (identifier: O43759-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSW → MLTLEFGILEFDPSWIGSWTQRSWVSWRSRPGCE
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:192
Mass (Da):21,591
Checksum:i2C42A04B3D8DDAA6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2A283A2A283_HUMAN
Synaptogyrin-1
SYNGR1
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCE4F8WCE4_HUMAN
Synaptogyrin-1
SYNGR1
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MCD7B5MCD7_HUMAN
Synaptogyrin-1
SYNGR1
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060489202P → PN4 Publications1
Natural variantiVAR_060490222D → G in a patient affected by schizophrenia. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0063311 – 33MEGGA…RVVSW → MLTLEFGILEFDPSWIGSWT QRSWVSWRSRPGCE in isoform 1C. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_006332162 – 233AGQAV…QSQGY → SLTAALAVRRFKDLSFQEEY STLFPASAQP in isoform 1B and isoform 1C. 3 PublicationsAdd BLAST72

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ002303 mRNA Translation: CAA05320.1
AJ002304 mRNA Translation: CAA05321.1
AJ002305 mRNA Translation: CAA05322.1
CR456590 mRNA Translation: CAG30476.1
BT007135 mRNA Translation: AAP35799.1
AK289507 mRNA Translation: BAF82196.1
AL022326 Genomic DNA No translation available.
BC000731 mRNA Translation: AAH00731.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13989.1 [O43759-1]
CCDS13990.1 [O43759-2]
CCDS13991.1 [O43759-3]

NCBI Reference Sequences

More...RefSeqi		NP_004702.2, NM_004711.4 [O43759-1]
NP_663783.1, NM_145731.3 [O43759-2]
NP_663791.1, NM_145738.2 [O43759-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000318801; ENSP00000318845; ENSG00000100321 [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321
ENST00000381535; ENSP00000370946; ENSG00000100321 [O43759-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9145

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9145

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000328933.10; ENSP00000332287.5; NM_004711.5; NP_004702.2

UCSC genome browser

More...UCSCi		uc003axo.5, human [O43759-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002303 mRNA Translation: CAA05320.1
AJ002304 mRNA Translation: CAA05321.1
AJ002305 mRNA Translation: CAA05322.1
CR456590 mRNA Translation: CAG30476.1
BT007135 mRNA Translation: AAP35799.1
AK289507 mRNA Translation: BAF82196.1
AL022326 Genomic DNA No translation available.
BC000731 mRNA Translation: AAH00731.1
CCDSiCCDS13989.1 [O43759-1]
CCDS13990.1 [O43759-2]
CCDS13991.1 [O43759-3]
RefSeqiNP_004702.2, NM_004711.4 [O43759-1]
NP_663783.1, NM_145731.3 [O43759-2]
NP_663791.1, NM_145738.2 [O43759-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi114592, 97 interactors
IntActiO43759, 33 interactors
MINTiO43759
STRINGi9606.ENSP00000332287

PTM databases

iPTMnetiO43759
PhosphoSitePlusiO43759
SwissPalmiO43759

Genetic variation databases

BioMutaiSYNGR1

Proteomic databases

EPDiO43759
jPOSTiO43759
MassIVEiO43759
MaxQBiO43759
PaxDbiO43759
PeptideAtlasiO43759
PRIDEiO43759
ProteomicsDBi49150 [O43759-1]
49151 [O43759-2]
49152 [O43759-3]
TopDownProteomicsiO43759-1 [O43759-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		26612, 177 antibodies from 31 providers

The DNASU plasmid repository

More...DNASUi		9145

Genome annotation databases

EnsembliENST00000318801; ENSP00000318845; ENSG00000100321 [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321
ENST00000381535; ENSP00000370946; ENSG00000100321 [O43759-3]
GeneIDi9145
KEGGihsa:9145
MANE-SelectiENST00000328933.10; ENSP00000332287.5; NM_004711.5; NP_004702.2
UCSCiuc003axo.5, human [O43759-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9145
DisGeNETi9145

GeneCards: human genes, protein and diseases

More...GeneCardsi		SYNGR1
HGNCiHGNC:11498, SYNGR1
HPAiENSG00000100321, Tissue enhanced (brain)
MIMi603925, gene
neXtProtiNX_O43759
OpenTargetsiENSG00000100321
PharmGKBiPA36280
VEuPathDBiHostDB:ENSG00000100321

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4016, Eukaryota
GeneTreeiENSGT00950000182935
HOGENOMiCLU_079186_0_1_1
InParanoidiO43759
OMAiNEQYSAS
OrthoDBi1549362at2759
PhylomeDBiO43759
TreeFamiTF320995

Enzyme and pathway databases

PathwayCommonsiO43759
ReactomeiR-HSA-6798695, Neutrophil degranulation
SignaLinkiO43759

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9145, 11 hits in 1039 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SYNGR1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SYNGR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9145
PharosiO43759, Tbio

Protein Ontology

More...PROi		PR:O43759
RNActiO43759, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000100321, Expressed in anterior cingulate cortex and 245 other tissues
ExpressionAtlasiO43759, baseline and differential
GenevisibleiO43759, HS

Family and domain databases

InterProiView protein in InterPro
IPR008253, Marvel
IPR016579, Synaptogyrin
PANTHERiPTHR10838, PTHR10838, 1 hit
PfamiView protein in Pfam
PF01284, MARVEL, 1 hit
PIRSFiPIRSF011282, Synaptogyrin, 1 hit
PROSITEiView protein in PROSITE
PS51225, MARVEL, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNG1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43759
Secondary accession number(s): A6NP69
, A8K0E2, O43757, O43758, Q53Y02, Q96J56, Q9UGZ4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 3, 2006
Last modified: February 23, 2022
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again