Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptogyrin-1

Gene

SYNGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).By similarity

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptogyrin-1Curated
Gene namesi
Name:SYNGR1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100321.14
HGNCiHGNC:11498 SYNGR1
MIMi603925 gene
neXtProtiNX_O43759

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 23CytoplasmicBy similarityAdd BLAST23
Transmembranei24 – 44HelicalSequence analysisAdd BLAST21
Topological domaini45 – 71LumenalBy similarityAdd BLAST27
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 103CytoplasmicBy similarityAdd BLAST11
Transmembranei104 – 124HelicalSequence analysisAdd BLAST21
Topological domaini125 – 148LumenalBy similarityAdd BLAST24
Transmembranei149 – 169HelicalSequence analysisAdd BLAST21
Topological domaini170 – 233CytoplasmicBy similarityAdd BLAST64

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi9145
OpenTargetsiENSG00000100321
PharmGKBiPA36280

Polymorphism and mutation databases

BioMutaiSYNGR1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001839901 – 233Synaptogyrin-1Add BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO43759
MaxQBiO43759
PaxDbiO43759
PeptideAtlasiO43759
PRIDEiO43759
ProteomicsDBi49150
49151 [O43759-2]
49152 [O43759-3]
TopDownProteomicsiO43759-1 [O43759-1]

PTM databases

iPTMnetiO43759
PhosphoSitePlusiO43759

Expressioni

Gene expression databases

BgeeiENSG00000100321 Expressed in 229 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_SYNGR1
ExpressionAtlasiO43759 baseline and differential
GenevisibleiO43759 HS

Organism-specific databases

HPAiCAB034277
HPA029673

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi114592, 7 interactors
IntActiO43759, 26 interactors
MINTiO43759
STRINGi9606.ENSP00000332287

Structurei

3D structure databases

ProteinModelPortaliO43759
SMRiO43759
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 173MARVELPROSITE-ProRule annotationAdd BLAST154

Sequence similaritiesi

Belongs to the synaptogyrin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4016 Eukaryota
ENOG4111F8S LUCA
GeneTreeiENSGT00510000046450
HOVERGENiHBG000896
InParanoidiO43759
OMAiWSQWSSA
OrthoDBiEOG091G0KKK
PhylomeDBiO43759
TreeFamiTF320995

Family and domain databases

InterProiView protein in InterPro
IPR008253 Marvel
IPR016579 Synaptogyrin
PANTHERiPTHR10838 PTHR10838, 1 hit
PfamiView protein in Pfam
PF01284 MARVEL, 1 hit
PIRSFiPIRSF011282 Synaptogyrin, 1 hit
PROSITEiView protein in PROSITE
PS51225 MARVEL, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1A (identifier: O43759-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGGAYGAGK AGGAFDPYTL VRQPHTILRV VSWLFSIVVF GSIVNEGYLN
60 70 80 90 100
SASEGEEFCI YNRNPNACSY GVAVGVLAFL TCLLYLALDV YFPQISSVKD
110 120 130 140 150
RKKAVLSDIG VSAFWAFLWF VGFCYLANQW QVSKPKDNPL NEGTDAARAA
160 170 180 190 200
IAFSFFSIFT WAGQAVLAFQ RYQIGADSAL FSQDYMDPSQ DSSMPYAPYV
210 220 230
EPTGPDPAGM GGTYQQPANT FDTEPQGYQS QGY
Length:233
Mass (Da):25,456
Last modified:October 3, 2006 - v2
Checksum:i8DE7000A46960213
GO
Isoform 1B (identifier: O43759-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:191
Mass (Da):21,038
Checksum:iB620694C3DAEF56C
GO
Isoform 1C (identifier: O43759-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSW → MLTLEFGILEFDPSWIGSWTQRSWVSWRSRPGCE
     162-233: AGQAVLAFQR...EPQGYQSQGY → SLTAALAVRRFKDLSFQEEYSTLFPASAQP

Show »
Length:192
Mass (Da):21,591
Checksum:i2C42A04B3D8DDAA6
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCD7B5MCD7_HUMAN
cDNA FLJ52856, highly similar to Sy...
SYNGR1
169Annotation score:
A2A283A2A283_HUMAN
Synaptogyrin-1
SYNGR1
118Annotation score:
F8WCE4F8WCE4_HUMAN
Synaptogyrin-1
SYNGR1
144Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060489202P → PN4 Publications1
Natural variantiVAR_060490222D → G in a patient affected by schizophrenia. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0063311 – 33MEGGA…RVVSW → MLTLEFGILEFDPSWIGSWT QRSWVSWRSRPGCE in isoform 1C. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_006332162 – 233AGQAV…QSQGY → SLTAALAVRRFKDLSFQEEY STLFPASAQP in isoform 1B and isoform 1C. 3 PublicationsAdd BLAST72

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002303 mRNA Translation: CAA05320.1
AJ002304 mRNA Translation: CAA05321.1
AJ002305 mRNA Translation: CAA05322.1
CR456590 mRNA Translation: CAG30476.1
BT007135 mRNA Translation: AAP35799.1
AK289507 mRNA Translation: BAF82196.1
AL022326 Genomic DNA No translation available.
BC000731 mRNA Translation: AAH00731.1
CCDSiCCDS13989.1 [O43759-1]
CCDS13990.1 [O43759-2]
CCDS13991.1 [O43759-3]
RefSeqiNP_004702.2, NM_004711.4 [O43759-1]
NP_663783.1, NM_145731.3 [O43759-2]
NP_663791.1, NM_145738.2 [O43759-3]
UniGeneiHs.216226

Genome annotation databases

EnsembliENST00000318801; ENSP00000318845; ENSG00000100321 [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321 [O43759-1]
ENST00000381535; ENSP00000370946; ENSG00000100321 [O43759-3]
GeneIDi9145
KEGGihsa:9145
UCSCiuc003axo.5 human [O43759-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002303 mRNA Translation: CAA05320.1
AJ002304 mRNA Translation: CAA05321.1
AJ002305 mRNA Translation: CAA05322.1
CR456590 mRNA Translation: CAG30476.1
BT007135 mRNA Translation: AAP35799.1
AK289507 mRNA Translation: BAF82196.1
AL022326 Genomic DNA No translation available.
BC000731 mRNA Translation: AAH00731.1
CCDSiCCDS13989.1 [O43759-1]
CCDS13990.1 [O43759-2]
CCDS13991.1 [O43759-3]
RefSeqiNP_004702.2, NM_004711.4 [O43759-1]
NP_663783.1, NM_145731.3 [O43759-2]
NP_663791.1, NM_145738.2 [O43759-3]
UniGeneiHs.216226

3D structure databases

ProteinModelPortaliO43759
SMRiO43759
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114592, 7 interactors
IntActiO43759, 26 interactors
MINTiO43759
STRINGi9606.ENSP00000332287

PTM databases

iPTMnetiO43759
PhosphoSitePlusiO43759

Polymorphism and mutation databases

BioMutaiSYNGR1

Proteomic databases

EPDiO43759
MaxQBiO43759
PaxDbiO43759
PeptideAtlasiO43759
PRIDEiO43759
ProteomicsDBi49150
49151 [O43759-2]
49152 [O43759-3]
TopDownProteomicsiO43759-1 [O43759-1]

Protocols and materials databases

DNASUi9145
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318801; ENSP00000318845; ENSG00000100321 [O43759-2]
ENST00000328933; ENSP00000332287; ENSG00000100321 [O43759-1]
ENST00000381535; ENSP00000370946; ENSG00000100321 [O43759-3]
GeneIDi9145
KEGGihsa:9145
UCSCiuc003axo.5 human [O43759-1]

Organism-specific databases

CTDi9145
DisGeNETi9145
EuPathDBiHostDB:ENSG00000100321.14
GeneCardsiSYNGR1
HGNCiHGNC:11498 SYNGR1
HPAiCAB034277
HPA029673
MIMi603925 gene
neXtProtiNX_O43759
OpenTargetsiENSG00000100321
PharmGKBiPA36280
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4016 Eukaryota
ENOG4111F8S LUCA
GeneTreeiENSGT00510000046450
HOVERGENiHBG000896
InParanoidiO43759
OMAiWSQWSSA
OrthoDBiEOG091G0KKK
PhylomeDBiO43759
TreeFamiTF320995

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRSiSYNGR1 human
GeneWikiiSYNGR1
GenomeRNAii9145
PROiPR:O43759
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100321 Expressed in 229 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_SYNGR1
ExpressionAtlasiO43759 baseline and differential
GenevisibleiO43759 HS

Family and domain databases

InterProiView protein in InterPro
IPR008253 Marvel
IPR016579 Synaptogyrin
PANTHERiPTHR10838 PTHR10838, 1 hit
PfamiView protein in Pfam
PF01284 MARVEL, 1 hit
PIRSFiPIRSF011282 Synaptogyrin, 1 hit
PROSITEiView protein in PROSITE
PS51225 MARVEL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSNG1_HUMAN
AccessioniPrimary (citable) accession number: O43759
Secondary accession number(s): A6NP69
, A8K0E2, O43757, O43758, Q53Y02, Q96J56, Q9UGZ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 3, 2006
Last modified: November 7, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again