Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (29 Sep 2021)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Sialic acid-binding Ig-like lectin 6

Gene

SIGLEC6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei122Sialic acidBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandLectin

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O43699

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sialic acid-binding Ig-like lectin 6
Short name:
Siglec-6
Alternative name(s):
CD33 antigen-like 1
CDw327
Obesity-binding protein 1
Short name:
OB-BP1
CD_antigen: CD327
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SIGLEC6
Synonyms:CD33L, CD33L1, OBBP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10875, SIGLEC6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604405, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43699

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000105492

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini27 – 347ExtracellularSequence analysisAdd BLAST321
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei348 – 368HelicalSequence analysisAdd BLAST21
Topological domaini369 – 453CytoplasmicSequence analysisAdd BLAST85

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
946

Open Targets

More...
OpenTargetsi
ENSG00000105492

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35776

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O43699, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SIGLEC6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001494627 – 453Sialic acid-binding Ig-like lectin 6Add BLAST427

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi46 ↔ 172PROSITE-ProRule annotation
Disulfide bondi51 ↔ 104PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi149N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi166 ↔ 215PROSITE-ProRule annotation
Glycosylationi233N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi274 ↔ 319PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O43699

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43699

PeptideAtlas

More...
PeptideAtlasi
O43699

PRoteomics IDEntifications database

More...
PRIDEi
O43699

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
30448
49120 [O43699-1]
49121 [O43699-2]
49122 [O43699-3]
49123 [O43699-4]
9453

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
O43699, 5 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43699

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43699

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in placenta (cyto- and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000105492, Expressed in placenta and 96 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43699, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43699, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000105492, Tissue enriched (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with LEP.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
107384, 7 interactors

Protein interaction database and analysis system

More...
IntActi
O43699, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000401502

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O43699, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43699

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini28 – 123Ig-like V-typeAdd BLAST96
Domaini148 – 231Ig-like C2-type 1Add BLAST84
Domaini238 – 333Ig-like C2-type 2Add BLAST96

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi424 – 429ITIM motif6
Motifi444 – 449SLAM-like motif6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S41V, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT01040000240469

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_024444_6_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43699

Identification of Orthologs from Complete Genome Data

More...
OMAi
SLFVQWS

Database of Orthologous Groups

More...
OrthoDBi
416689at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43699

TreeFam database of animal gene trees

More...
TreeFami
TF332441

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003006, Ig/MHC_CS
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR013151, Immunoglobulin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679, I-set, 1 hit
PF00047, ig, 1 hit
PF07686, V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409, IG, 3 hits
SM00408, IGc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835, IG_LIKE, 2 hits
PS00290, IG_MHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O43699-1) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound, CD33L1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGAQEASAS EMLPLLLPLL WAGALAQERR FQLEGPESLT VQEGLCVLVP
60 70 80 90 100
CRLPTTLPAS YYGYGYWFLE GADVPVATND PDEEVQEETR GRFHLLWDPR
110 120 130 140 150
RKNCSLSIRD ARRRDNAAYF FRLKSKWMKY GYTSSKLSVR VMALTHRPNI
160 170 180 190 200
SIPGTLESGH PSNLTCSVPW VCEQGTPPIF SWMSAAPTSL GPRTTQSSVL
210 220 230 240 250
TITPRPQDHS TNLTCQVTFP GAGVTMERTI QLNVSYAPQK VAISIFQGNS
260 270 280 290 300
AAFKILQNTS SLPVLEGQAL RLLCDADGNP PAHLSWFQGF PALNATPISN
310 320 330 340 350
TGVLELPQVG SAEEGDFTCR AQHPLGSLQI SLSLFVHWKP EGRAGGVLGA
360 370 380 390 400
VWGASITTLV FLCVCFIFRV KTRRKKAAQP VQNTDDVNPV MVSGSRGHQH
410 420 430 440 450
QFQTGIVSDH PAEAGPISED EQELHYAVLH FHKVQPQEPK VTDTEYSEIK

IHK
Length:453
Mass (Da):49,913
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9DD7FBD8F059E452
GO
Isoform 2 (identifier: O43699-2) [UniParc]FASTAAdd to basket
Also known as: Secreted, CD33L2

The sequence of this isoform differs from the canonical sequence as follows:
     339-391: KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM → SSAPVPDRHSFRPPC
     392-453: Missing.

Note: Should not be confused with SIGLEC5 which has been called CD33L2.Curated
Show »
Length:353
Mass (Da):38,808
Checksum:i4B92E4AEE7F85F4A
GO
Isoform 3 (identifier: O43699-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-252: YAPQKVAISIFQGNSAA → S

Show »
Length:437
Mass (Da):48,253
Checksum:i7F8019D0A7B4F8CA
GO
Isoform 4 (identifier: O43699-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     143-153: Missing.
     339-391: KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM → SSAPVPDRHSFRPPC
     392-453: Missing.

Show »
Length:342
Mass (Da):37,608
Checksum:iA954E3391E2789CE
GO
Isoform 5 (identifier: O43699-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: Y → WMLRRPPLSTPD
     371-453: KTRRKKAAQP...TEYSEIKIHK → ISTSSRQA

Show »
Length:389
Mass (Da):42,642
Checksum:iC1BB8F4042F8FB03
GO
Isoform 6 (identifier: O43699-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     23-58: Missing.
     236-252: YAPQKVAISIFQGNSAA → S

Show »
Length:401
Mass (Da):44,348
Checksum:i3F487B113CADB0C4
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB70702 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH35359 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI40799 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA24983 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA24984 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti6E → K in BAA24983 (PubMed:9465907).Curated1
Sequence conflicti6E → K in BAA24984 (PubMed:9465907).Curated1
Sequence conflicti137 – 138LS → IY in AAB70702 (PubMed:10428856).Curated2
Sequence conflicti155 – 161TLESGHP → PGVWPS in AAB70702 (PubMed:10428856).Curated7
Sequence conflicti183M → T in AK300170 (PubMed:14702039).Curated1
Sequence conflicti188 – 189TS → HL in AAB70702 (PubMed:10428856).Curated2
Sequence conflicti205 – 206RP → A in AAB70702 (PubMed:10428856).Curated2
Sequence conflicti389P → L in AK300170 (PubMed:14702039).Curated1
Isoform 5 (identifier: O43699-5)
Sequence conflicti246P → S in AK300182 (PubMed:10428856).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01425257L → V1 PublicationCorresponds to variant dbSNP:rs2305773Ensembl.1
Natural variantiVAR_014253262L → F. Corresponds to variant dbSNP:rs2005199Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04607023 – 58Missing in isoform 6. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035811143 – 153Missing in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_035812236 – 252YAPQK…GNSAA → S in isoform 3 and isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_045387236Y → WMLRRPPLSTPD in isoform 5. 1 Publication1
Alternative sequenceiVSP_002553339 – 391KPEGR…VNPVM → SSAPVPDRHSFRPPC in isoform 2 and isoform 4. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_045388371 – 453KTRRK…IKIHK → ISTSSRQA in isoform 5. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_002554392 – 453Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D86358 mRNA Translation: BAA24983.1 Different initiation.
D86359 mRNA Translation: BAA24984.1 Different initiation.
AK300170 mRNA No translation available.
AK300182 mRNA No translation available.
AC020914 Genomic DNA No translation available.
BC035359 mRNA Translation: AAH35359.2 Different initiation.
BC140798 mRNA Translation: AAI40799.1 Different initiation.
U71382 mRNA Translation: AAB70702.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12834.3 [O43699-1]
CCDS12835.3 [O43699-3]
CCDS12836.3 [O43699-2]
CCDS54307.1 [O43699-6]
CCDS54308.1 [O43699-5]
CCDS59417.1 [O43699-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001171018.1, NM_001177547.2 [O43699-6]
NP_001171019.1, NM_001177548.2 [O43699-5]
NP_001171020.1, NM_001177549.2 [O43699-4]
NP_001236.4, NM_001245.6 [O43699-1]
NP_942142.3, NM_198845.5 [O43699-3]
NP_942143.3, NM_198846.5 [O43699-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343300; ENSP00000345907; ENSG00000105492 [O43699-2]
ENST00000346477; ENSP00000344064; ENSG00000105492 [O43699-3]
ENST00000359982; ENSP00000353071; ENSG00000105492 [O43699-5]
ENST00000391797; ENSP00000375674; ENSG00000105492 [O43699-4]
ENST00000425629; ENSP00000401502; ENSG00000105492 [O43699-1]
ENST00000436458; ENSP00000410679; ENSG00000105492 [O43699-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
946

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:946

UCSC genome browser

More...
UCSCi
uc002pwy.4, human [O43699-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Siglec-6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86358 mRNA Translation: BAA24983.1 Different initiation.
D86359 mRNA Translation: BAA24984.1 Different initiation.
AK300170 mRNA No translation available.
AK300182 mRNA No translation available.
AC020914 Genomic DNA No translation available.
BC035359 mRNA Translation: AAH35359.2 Different initiation.
BC140798 mRNA Translation: AAI40799.1 Different initiation.
U71382 mRNA Translation: AAB70702.1 Different initiation.
CCDSiCCDS12834.3 [O43699-1]
CCDS12835.3 [O43699-3]
CCDS12836.3 [O43699-2]
CCDS54307.1 [O43699-6]
CCDS54308.1 [O43699-5]
CCDS59417.1 [O43699-4]
RefSeqiNP_001171018.1, NM_001177547.2 [O43699-6]
NP_001171019.1, NM_001177548.2 [O43699-5]
NP_001171020.1, NM_001177549.2 [O43699-4]
NP_001236.4, NM_001245.6 [O43699-1]
NP_942142.3, NM_198845.5 [O43699-3]
NP_942143.3, NM_198846.5 [O43699-2]

3D structure databases

SMRiO43699
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107384, 7 interactors
IntActiO43699, 14 interactors
STRINGi9606.ENSP00000401502

PTM databases

GlyGeniO43699, 5 sites
iPTMnetiO43699
PhosphoSitePlusiO43699

Genetic variation databases

BioMutaiSIGLEC6

Proteomic databases

MassIVEiO43699
PaxDbiO43699
PeptideAtlasiO43699
PRIDEiO43699
ProteomicsDBi30448
49120 [O43699-1]
49121 [O43699-2]
49122 [O43699-3]
49123 [O43699-4]
9453

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2300, 384 antibodies

The DNASU plasmid repository

More...
DNASUi
946

Genome annotation databases

EnsembliENST00000343300; ENSP00000345907; ENSG00000105492 [O43699-2]
ENST00000346477; ENSP00000344064; ENSG00000105492 [O43699-3]
ENST00000359982; ENSP00000353071; ENSG00000105492 [O43699-5]
ENST00000391797; ENSP00000375674; ENSG00000105492 [O43699-4]
ENST00000425629; ENSP00000401502; ENSG00000105492 [O43699-1]
ENST00000436458; ENSP00000410679; ENSG00000105492 [O43699-6]
GeneIDi946
KEGGihsa:946
UCSCiuc002pwy.4, human [O43699-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
946
DisGeNETi946

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SIGLEC6
HGNCiHGNC:10875, SIGLEC6
HPAiENSG00000105492, Tissue enriched (placenta)
MIMi604405, gene
neXtProtiNX_O43699
OpenTargetsiENSG00000105492
PharmGKBiPA35776
VEuPathDBiHostDB:ENSG00000105492

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S41V, Eukaryota
GeneTreeiENSGT01040000240469
HOGENOMiCLU_024444_6_1_1
InParanoidiO43699
OMAiSLFVQWS
OrthoDBi416689at2759
PhylomeDBiO43699
TreeFamiTF332441

Enzyme and pathway databases

PathwayCommonsiO43699
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
946, 10 hits in 1009 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SIGLEC6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
946
PharosiO43699, Tbio

Protein Ontology

More...
PROi
PR:O43699
RNActiO43699, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000105492, Expressed in placenta and 96 other tissues
ExpressionAtlasiO43699, baseline and differential
GenevisibleiO43699, HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003006, Ig/MHC_CS
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR013151, Immunoglobulin
PfamiView protein in Pfam
PF07679, I-set, 1 hit
PF00047, ig, 1 hit
PF07686, V-set, 1 hit
SMARTiView protein in SMART
SM00409, IG, 3 hits
SM00408, IGc2, 1 hit
SUPFAMiSSF48726, SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 2 hits
PS00290, IG_MHC, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSIGL6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43699
Secondary accession number(s): A8MV71
, B2RTS8, C9JBE5, F8WA78, O15388, O43700
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 25, 2008
Last modified: September 29, 2021
This is version 182 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again