Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O43679 (LDB2_HUMAN)

Entry version 167 (25 May 2022)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Add a publicationFeedback
Protein

LIM domain-binding protein 2

Gene

LDB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43679

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O43679

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain-binding protein 2
Short name:
LDB-2
Alternative name(s):
Carboxyl-terminal LIM domain-binding protein 1
Short name:
CLIM-1
LIM domain-binding factor CLIM1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LDB2
Synonyms:CLIM1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:6533, LDB2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603450, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43679

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000169744

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9079

Open Targets

More...OpenTargetsi		ENSG00000169744

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30317

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43679, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LDB2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000843871 – 373LIM domain-binding protein 2Add BLAST373

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43679

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43679

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43679

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43679

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43679

PeptideAtlas

More...PeptideAtlasi		O43679

PRoteomics IDEntifications database

More...PRIDEi		O43679

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		49107 [O43679-1]
49108 [O43679-2]
49109 [O43679-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43679

MetOSite database of methionine sulfoxide sites

More...MetOSitei		O43679

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43679

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169744, Expressed in forebrain and 229 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43679, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43679, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000169744, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with LHX9 (By similarity).

Interacts with SLK; leading to negatively regulate SLK kinase activity (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114535, 28 interactors

Database of interacting proteins

More...DIPi		DIP-24262N
DIP-41215N

Protein interaction database and analysis system

More...IntActi		O43679, 30 interactors

Molecular INTeraction database

More...MINTi		O43679

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000306772

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43679, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		O43679

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43679

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini298 – 337LIM interaction domain (LID)PROSITE-ProRule annotationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni244 – 291DisorderedSequence analysisAdd BLAST48
Regioni327 – 373DisorderedSequence analysisAdd BLAST47

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi264 – 291Polar residuesSequence analysisAdd BLAST28
Compositional biasi342 – 373Polar residuesSequence analysisAdd BLAST32

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LDB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2181, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000005639

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43679

Identification of Orthologs from Complete Genome Data

More...OMAi		PWNSKPA

Database of Orthologous Groups

More...OrthoDBi		849287at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43679

TreeFam database of animal gene trees

More...TreeFami		TF319923

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR030174, LDB2
IPR041363, LID
IPR029005, LIM-bd/SEUSS

The PANTHER Classification System

More...PANTHERi		PTHR10378, PTHR10378, 1 hit
PTHR10378:SF8, PTHR10378:SF8, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51957, LID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43679-1) [UniParc]FASTAAdd to basket
Also known as: a, CLIM1a

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSTPHDPFY SSPFGPFYRR HTPYMVQPEY RIYEMNKRLQ SRTEDSDNLW 
        60         70         80         90        100
WDAFATEFFE DDATLTLSFC LEDGPKRYTI GRTLIPRYFS TVFEGGVTDL 
       110        120        130        140        150
YYILKHSKES YHNSSITVDC DQCTMVTQHG KPMFTKVCTE GRLILEFTFD 
       160        170        180        190        200
DLMRIKTWHF TIRQYRELVP RSILAMHAQD PQVLDQLSKN ITRMGLTNFT 
       210        220        230        240        250
LNYLRLCVIL EPMQELMSRH KTYNLSPRDC LKTCLFQKWQ RMVAPPAEPT 
       260        270        280        290        300
RQPTTKRRKR KNSTSSTSNS SAGNNANSTG SKKKTTAANL SLSSQVPDVM 
       310        320        330        340        350
VVGEPTLMGG EFGDEDERLI TRLENTQYDA ANGMDDEEDF NNSPALGNNS 
       360        370 
PWNSKPPATQ ETKSENPPPQ ASQ
Length:373
Mass (Da):42,793
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE86387BA027F383A
GO
Isoform 2 (identifier: O43679-2) [UniParc]FASTAAdd to basket
Also known as: b, CLIM1b

The sequence of this isoform differs from the canonical sequence as follows:
     298-331: DVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA → GLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH
     332-373: Missing.

Note: Lacks LIM-binding domain.Curated
Show »
Length:331
Mass (Da):38,005
Checksum:iF1FFE930C99FB3F8
GO
Isoform 3 (identifier: O43679-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: Missing.
     296-297: Missing.

Show »
Length:347
Mass (Da):39,740
Checksum:iB46DD3274FC5AFF2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E9Y7G5E9Y7_HUMAN
LIM domain binding 2, isoform CRA_b
LDB2 hCG_1811661
371Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA09H0YA09_HUMAN
LIM domain-binding protein 2
LDB2
294Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PFI4E9PFI4_HUMAN
LIM domain-binding protein 2
LDB2
313Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAT1D6RAT1_HUMAN
LIM domain-binding protein 2
LDB2
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PGU0E9PGU0_HUMAN
LIM domain-binding protein 2
LDB2
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EX95E7EX95_HUMAN
LIM domain-binding protein 2
LDB2
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0278251 – 24Missing in isoform 3. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_027828296 – 297Missing in isoform 3. 1 Publication2
Alternative sequenceiVSP_027826298 – 331DVMVV…QYDAA → GLGAIPNCSLNPGRDGDLCH STAVTPSGQFKEKH in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_027827332 – 373Missing in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF068651 mRNA Translation: AAC77817.1
AF052389 mRNA Translation: AAC13274.1
AF064492 mRNA Translation: AAC28342.1
AF064493 mRNA Translation: AAC28343.1
AF047337 mRNA Translation: AAC83552.1
BC034019 mRNA Translation: AAH34019.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3420.1 [O43679-1]
CCDS47031.1 [O43679-2]

NCBI Reference Sequences

More...RefSeqi		NP_001124306.1, NM_001130834.2 [O43679-2]
NP_001281.1, NM_001290.4 [O43679-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000304523.10; ENSP00000306772.5; ENSG00000169744.13
ENST00000441778.6; ENSP00000392089.2; ENSG00000169744.13 [O43679-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9079

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9079

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000304523.10; ENSP00000306772.5; NM_001290.5; NP_001281.1

UCSC genome browser

More...UCSCi		uc003goz.5, human [O43679-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF068651 mRNA Translation: AAC77817.1
AF052389 mRNA Translation: AAC13274.1
AF064492 mRNA Translation: AAC28342.1
AF064493 mRNA Translation: AAC28343.1
AF047337 mRNA Translation: AAC83552.1
BC034019 mRNA Translation: AAH34019.1
CCDSiCCDS3420.1 [O43679-1]
CCDS47031.1 [O43679-2]
RefSeqiNP_001124306.1, NM_001130834.2 [O43679-2]
NP_001281.1, NM_001290.4 [O43679-1]

3D structure databases

AlphaFoldDBiO43679
SMRiO43679
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114535, 28 interactors
DIPiDIP-24262N
DIP-41215N
IntActiO43679, 30 interactors
MINTiO43679
STRINGi9606.ENSP00000306772

PTM databases

iPTMnetiO43679
MetOSiteiO43679
PhosphoSitePlusiO43679

Genetic variation databases

BioMutaiLDB2

Proteomic databases

EPDiO43679
jPOSTiO43679
MassIVEiO43679
MaxQBiO43679
PaxDbiO43679
PeptideAtlasiO43679
PRIDEiO43679
ProteomicsDBi49107 [O43679-1]
49108 [O43679-2]
49109 [O43679-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4310, 235 antibodies from 27 providers

The DNASU plasmid repository

More...DNASUi		9079

Genome annotation databases

EnsembliENST00000304523.10; ENSP00000306772.5; ENSG00000169744.13
ENST00000441778.6; ENSP00000392089.2; ENSG00000169744.13 [O43679-2]
GeneIDi9079
KEGGihsa:9079
MANE-SelectiENST00000304523.10; ENSP00000306772.5; NM_001290.5; NP_001281.1
UCSCiuc003goz.5, human [O43679-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9079
DisGeNETi9079

GeneCards: human genes, protein and diseases

More...GeneCardsi		LDB2
HGNCiHGNC:6533, LDB2
HPAiENSG00000169744, Low tissue specificity
MIMi603450, gene
neXtProtiNX_O43679
OpenTargetsiENSG00000169744
PharmGKBiPA30317
VEuPathDBiHostDB:ENSG00000169744

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2181, Eukaryota
GeneTreeiENSGT00390000005639
InParanoidiO43679
OMAiPWNSKPA
OrthoDBi849287at2759
PhylomeDBiO43679
TreeFamiTF319923

Enzyme and pathway databases

PathwayCommonsiO43679
SignaLinkiO43679

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9079, 6 hits in 1072 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LDB2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		LDB2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9079
PharosiO43679, Tbio

Protein Ontology

More...PROi		PR:O43679
RNActiO43679, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169744, Expressed in forebrain and 229 other tissues
ExpressionAtlasiO43679, baseline and differential
GenevisibleiO43679, HS

Family and domain databases

InterProiView protein in InterPro
IPR030174, LDB2
IPR041363, LID
IPR029005, LIM-bd/SEUSS
PANTHERiPTHR10378, PTHR10378, 1 hit
PTHR10378:SF8, PTHR10378:SF8, 1 hit
PfamiView protein in Pfam
PF17916, LID, 1 hit
PF01803, LIM_bind, 2 hits
PROSITEiView protein in PROSITE
PS51957, LID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLDB2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43679
Secondary accession number(s): O60619, O75480
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: June 1, 1998
Last modified: May 25, 2022
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again