Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein regulator of cytokinesis 1

Gene

PRC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key regulator of cytokinesis that cross-links antiparrallel microtubules at an average distance of 35 nM. Essential for controlling the spatiotemporal formation of the midzone and successful cytokinesis. Required for KIF14 localization to the central spindle and midbody. Required to recruit PLK1 to the spindle. Stimulates PLK1 phosphorylation of RACGAP1 to allow recruitment of ECT2 to the central spindle. Acts as an oncogene for promoting bladder cancer cells proliferation, apoptosis inhibition and carcinogenic progression (PubMed:17409436).8 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei377Tubulin1
Binding sitei387Tubulin1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • microtubule bundle formation Source: InterPro
  • mitotic spindle elongation Source: ProtInc
  • positive regulation of cell proliferation Source: UniProtKB
  • regulation of cytokinesis Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5625900 RHO GTPases activate CIT

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O43663

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein regulator of cytokinesis 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRC1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000198901.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9341 PRC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603484 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43663

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi470T → A: No effect. Abolishes CDK1-mediated phosphorylation, leading to prematurely recruit PLK1 to the spindle during prometaphase and blocking mitotic progression; when associated with A-481. 3 Publications1
Mutagenesisi481T → A: No effect. Reduces in vitro cyclin E-CDK2 phosphorylation and causes extensive bundling of microtubules to the mitotic spindle; when associated with A-470. 3 Publications1
Mutagenesisi577 – 578ST → AA: Weakly reduces binding to the POLO box domains of PLK1. 1 Publication2
Mutagenesisi615 – 616ST → AA: Impairs binding to the POLO box domains of PLK1, preventing phosphorylation by PLK1 and recruitment of PLK1 to the spindle. 1 Publication2

Keywords - Diseasei

Oncogene

Organism-specific databases

DisGeNET

More...
DisGeNETi
9055

Open Targets

More...
OpenTargetsi
ENSG00000198901

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33703

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PRC1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002297371 – 620Protein regulator of cytokinesis 1Add BLAST620

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei470Phosphothreonine; by CDK1Combined sources3 Publications1
Modified residuei481Phosphothreonine; by CDK1Combined sources3 Publications1
Modified residuei513PhosphoserineCombined sources1
Modified residuei571PhosphoserineCombined sources1
Modified residuei578Phosphothreonine1 Publication1
Modified residuei616Phosphothreonine; by PLK11 Publication1
Isoform 21 Publication (identifier: O43663-2)
Modified residuei541PhosphoserineCombined sources1
Isoform 4 (identifier: O43663-4)
Modified residuei571PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by CDK1 in early mitosis holds PRC1 in an inactive monomeric state, during the metaphase to anaphase transition, PRC1 is dephosphorylated, promoting interaction with KIF4A, which then translocates PRC1 along mitotic spindles to the plus ends of antiparallel interdigitating microtubules. Dephosphorylation also promotes MT-bundling activity by allowing dimerization. Phosphorylation by CDK1 prevents PLK1-binding: upon degradation of CDK1 at anaphase and dephosphorylation, it is then phosphorylated by PLK1, leading to cytokinesis.3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O43663

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43663

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43663

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43663

PeptideAtlas

More...
PeptideAtlasi
O43663

PRoteomics IDEntifications database

More...
PRIDEi
O43663

ProteomicsDB human proteome resource

More...
ProteomicsDBi
49093
49094 [O43663-2]
49095 [O43663-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43663

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43663

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Overexpressed in bladder cancer cells (PubMed:17409436).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198901 Expressed in 170 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_PRC1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43663 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43663 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034521

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (PubMed:20691902). Interacts with the C-terminal Rho-GAP domain and the basic region of RACGAP1 (PubMed:14744859). The interaction with RACGAP1 inhibits its GAP activity towards CDC42 in vitro, which may be required for maintaining normal spindle morphology (PubMed:14744859). Interacts separately via its N-terminal region with the C-terminus of CENPE, KIF4A and KIF23 during late mitosis (PubMed:15297875, PubMed:16431929). Interacts with KIF14 and KIF20A (PubMed:15625105, PubMed:16431929). Interacts with PLK1 (PubMed:19468300). Interacts with KIF20B (PubMed:17409436).7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TRIM37O949723EBI-741137,EBI-741602

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114517, 44 interactors

Database of interacting proteins

More...
DIPi
DIP-34436N

Protein interaction database and analysis system

More...
IntActi
O43663, 18 interactors

Molecular INTeraction database

More...
MINTi
O43663

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377793

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1620
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NRXX-ray1.75A/B341-466[»]
3NRYX-ray2.00A341-466[»]
4L3IX-ray3.60A/B1-486[»]
4L6YX-ray3.30A/B1-486[»]
5KMGelectron microscopy3.50P341-464[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O43663

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43663

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O43663

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 341DimerizationAdd BLAST341
Regioni342 – 466Spectrin-foldAdd BLAST125
Regioni467 – 620Unstructured, Arg/Lys richAdd BLAST154

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili96 – 133Sequence analysisAdd BLAST38
Coiled coili211 – 304Sequence analysisAdd BLAST94
Coiled coili383 – 463Sequence analysisAdd BLAST81

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Microtubule binding occurs via a basic patch in the central spectrin-like domain and requires also the unstructured C-terminal domain.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAP65/ASE1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4302 Eukaryota
ENOG410YZBK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009453

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000082534

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052963

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43663

KEGG Orthology (KO)

More...
KOi
K16732

Identification of Orthologs from Complete Genome Data

More...
OMAi
AQYWDQC

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43663

TreeFam database of animal gene trees

More...
TreeFami
TF323976

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007145 MAP65_Ase1_PRC1
IPR032921 PRC1

The PANTHER Classification System

More...
PANTHERi
PTHR19321 PTHR19321, 1 hit
PTHR19321:SF1 PTHR19321:SF1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: O43663-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRSEVLAEE SIVCLQKALN HLREIWELIG IPEDQRLQRT EVVKKHIKEL
60 70 80 90 100
LDMMIAEEES LKERLIKSIS VCQKELNTLC SELHVEPFQE EGETTILQLE
110 120 130 140 150
KDLRTQVELM RKQKKERKQE LKLLQEQDQE LCEILCMPHY DIDSASVPSL
160 170 180 190 200
EELNQFRQHV TTLRETKASR REEFVSIKRQ IILCMEALDH TPDTSFERDV
210 220 230 240 250
VCEDEDAFCL SLENIATLQK LLRQLEMQKS QNEAVCEGLR TQIRELWDRL
260 270 280 290 300
QIPEEEREAV ATIMSGSKAK VRKALQLEVD RLEELKMQNM KKVIEAIRVE
310 320 330 340 350
LVQYWDQCFY SQEQRQAFAP FCAEDYTESL LQLHDAEIVR LKNYYEVHKE
360 370 380 390 400
LFEGVQKWEE TWRLFLEFER KASDPNRFTN RGGNLLKEEK QRAKLQKMLP
410 420 430 440 450
KLEEELKARI ELWEQEHSKA FMVNGQKFME YVAEQWEMHR LEKERAKQER
460 470 480 490 500
QLKNKKQTET EMLYGSAPRT PSKRRGLAPN TPGKARKLNT TTMSNATANS
510 520 530 540 550
SIRPIFGGTV YHSPVSRLPP SGSKPVAAST CSGKKTPRTG RHGANKENLE
560 570 580 590 600
LNGSILSGGY PGSAPLQRNF SINSVASTYS EFAKDPSLSD SSTVGLQREL
610 620
SKASKSDATS GILNSTNIQS
Length:620
Mass (Da):71,607
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i28393C5B1B3662F3
GO
Isoform 21 Publication (identifier: O43663-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: Missing.
     584-597: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:576
Mass (Da):66,596
Checksum:i99DFC0F36E2BC312
GO
Isoform 3 (identifier: O43663-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-90: Missing.
     558-620: GGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS → ARTFKGFQI

Note: No experimental confirmation available.
Show »
Length:525
Mass (Da):61,388
Checksum:i609991EF3214602F
GO
Isoform 4 (identifier: O43663-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     584-597: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:606
Mass (Da):70,191
Checksum:iFED638FB918F6A35
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V3N7G3V3N7_HUMAN
Protein regulator of cytokinesis 1
PRC1
238Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YL53H0YL53_HUMAN
Protein regulator of cytokinesis 1
PRC1
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YM42H0YM42_HUMAN
Protein regulator of cytokinesis 1
PRC1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLA0H0YLA0_HUMAN
Protein regulator of cytokinesis 1
PRC1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YNE4H0YNE4_HUMAN
Protein regulator of cytokinesis 1
PRC1
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSJ8H3BSJ8_HUMAN
Protein regulator of cytokinesis 1
PRC1
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti416E → G in BX647317 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047768187A → E3 PublicationsCorresponds to variant dbSNP:rs7172758Ensembl.1
Natural variantiVAR_047769511Y → C. Corresponds to variant dbSNP:rs12911192EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03587550 – 90Missing in isoform 3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_051979397 – 426Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_035876558 – 620GGYPG…TNIQS → ARTFKGFQI in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_051980584 – 597Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF044588 mRNA Translation: AAC02688.1
AK297117 mRNA Translation: BAG59623.1
AC068831 Genomic DNA No translation available.
BC003138 mRNA Translation: AAH03138.1
BC005140 mRNA Translation: AAH05140.1
BX647317 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32334.1 [O43663-1]
CCDS45352.1 [O43663-4]
CCDS45353.2 [O43663-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001254509.1, NM_001267580.1
NP_003972.1, NM_003981.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.366401

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361188; ENSP00000354679; ENSG00000198901 [O43663-4]
ENST00000394249; ENSP00000377793; ENSG00000198901 [O43663-1]
ENST00000442656; ENSP00000409549; ENSG00000198901 [O43663-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9055

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9055

UCSC genome browser

More...
UCSCi
uc002bqm.5 human [O43663-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF044588 mRNA Translation: AAC02688.1
AK297117 mRNA Translation: BAG59623.1
AC068831 Genomic DNA No translation available.
BC003138 mRNA Translation: AAH03138.1
BC005140 mRNA Translation: AAH05140.1
BX647317 mRNA No translation available.
CCDSiCCDS32334.1 [O43663-1]
CCDS45352.1 [O43663-4]
CCDS45353.2 [O43663-3]
RefSeqiNP_001254509.1, NM_001267580.1
NP_003972.1, NM_003981.3
UniGeneiHs.366401

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NRXX-ray1.75A/B341-466[»]
3NRYX-ray2.00A341-466[»]
4L3IX-ray3.60A/B1-486[»]
4L6YX-ray3.30A/B1-486[»]
5KMGelectron microscopy3.50P341-464[»]
ProteinModelPortaliO43663
SMRiO43663
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114517, 44 interactors
DIPiDIP-34436N
IntActiO43663, 18 interactors
MINTiO43663
STRINGi9606.ENSP00000377793

PTM databases

iPTMnetiO43663
PhosphoSitePlusiO43663

Polymorphism and mutation databases

BioMutaiPRC1

Proteomic databases

EPDiO43663
jPOSTiO43663
MaxQBiO43663
PaxDbiO43663
PeptideAtlasiO43663
PRIDEiO43663
ProteomicsDBi49093
49094 [O43663-2]
49095 [O43663-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9055
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361188; ENSP00000354679; ENSG00000198901 [O43663-4]
ENST00000394249; ENSP00000377793; ENSG00000198901 [O43663-1]
ENST00000442656; ENSP00000409549; ENSG00000198901 [O43663-3]
GeneIDi9055
KEGGihsa:9055
UCSCiuc002bqm.5 human [O43663-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9055
DisGeNETi9055
EuPathDBiHostDB:ENSG00000198901.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PRC1
HGNCiHGNC:9341 PRC1
HPAiHPA034521
MIMi603484 gene
neXtProtiNX_O43663
OpenTargetsiENSG00000198901
PharmGKBiPA33703

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4302 Eukaryota
ENOG410YZBK LUCA
GeneTreeiENSGT00390000009453
HOGENOMiHOG000082534
HOVERGENiHBG052963
InParanoidiO43663
KOiK16732
OMAiAQYWDQC
PhylomeDBiO43663
TreeFamiTF323976

Enzyme and pathway databases

ReactomeiR-HSA-5625900 RHO GTPases activate CIT
SIGNORiO43663

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PRC1 human
EvolutionaryTraceiO43663

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PRC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9055

Protein Ontology

More...
PROi
PR:O43663

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198901 Expressed in 170 organ(s), highest expression level in testis
CleanExiHS_PRC1
ExpressionAtlasiO43663 baseline and differential
GenevisibleiO43663 HS

Family and domain databases

InterProiView protein in InterPro
IPR007145 MAP65_Ase1_PRC1
IPR032921 PRC1
PANTHERiPTHR19321 PTHR19321, 1 hit
PTHR19321:SF1 PTHR19321:SF1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43663
Secondary accession number(s): A6NC44
, B4DLR1, H9KV59, Q9BSB6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: November 25, 2008
Last modified: January 16, 2019
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again