Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43581 (SYT7_HUMAN)

Entry version 183 (10 Feb 2021)
Sequence version 3 (23 Sep 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Synaptotagmin-7

Gene

SYT7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ca2+ sensor involved in Ca2+-dependent exocytosis of secretory and synaptic vesicles through Ca2+ and phospholipid binding to the C2 domain (By similarity). Ca2+ induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis (By similarity). SYT7 binds Ca2+ with high affinity and slow kinetics compared to other synaptotagmins (By similarity). Involved in Ca2+-triggered lysosomal exocytosis, a major component of the plasma membrane repair (PubMed:11342594). Ca2+-regulated delivery of lysosomal membranes to the cell surface is also involved in the phagocytic uptake of particles by macrophages (By similarity). Ca2+-triggered lysosomal exocytosis also plays a role in bone remodeling by regulating secretory pathways in osteoclasts and osteoblasts (By similarity). In case of infection, involved in participates cell invasion by Trypanosoma cruzi via Ca2+-triggered lysosomal exocytosis (PubMed:11342594, PubMed:15811535). Involved in cholesterol transport from lysosome to peroxisome by promoting membrane contacts between lysosomes and peroxisomes: probably acts by promoting vesicle fusion by binding phosphatidylinositol-4,5-bisphosphate on peroxisomal membranes (By similarity). Acts as a key mediator of synaptic facilitation, a process also named short-term synaptic potentiation: synaptic facilitation takes place at synapses with a low initial release probability and is caused by influx of Ca2+ into the axon terminal after spike generation, increasing the release probability of neurotransmitters (By similarity). Probably mediates synaptic facilitation by directly increasing the probability of release (By similarity). May also contribute to synaptic facilitation by regulating synaptic vesicle replenishment, a process required to ensure that synaptic vesicles are ready for the arrival of the next action potential: SYT7 is required for synaptic vesicle replenishment by acting as a sensor for Ca2+ and by forming a complex with calmodulin (By similarity). Also acts as a regulator of Ca2+-dependent insulin and glucagon secretion in beta-cells (By similarity). Triggers exocytosis by promoting fusion pore opening and fusion pore expansion in chromaffin cells (By similarity). Also regulates the secretion of some non-synaptic secretory granules of specialized cells (By similarity).By similarity2 Publications

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+PROSITE-ProRule annotationNote: Binds 3 Ca2+ ions per C2 domain.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi166Calcium 1PROSITE-ProRule annotation1
Metal bindingi166Calcium 2PROSITE-ProRule annotation1
Metal bindingi172Calcium 1PROSITE-ProRule annotation1
Metal bindingi225Calcium 1PROSITE-ProRule annotation1
Metal bindingi225Calcium 2PROSITE-ProRule annotation1
Metal bindingi227Calcium 1PROSITE-ProRule annotation1
Metal bindingi227Calcium 2PROSITE-ProRule annotation1
Metal bindingi227Calcium 3PROSITE-ProRule annotation1
Metal bindingi230Calcium 3PROSITE-ProRule annotation1
Metal bindingi233Calcium 2PROSITE-ProRule annotation1
Metal bindingi233Calcium 3PROSITE-ProRule annotation1
Metal bindingi297Calcium 4PROSITE-ProRule annotation1
Metal bindingi297Calcium 5PROSITE-ProRule annotation1
Metal bindingi303Calcium 4PROSITE-ProRule annotation1
Metal bindingi357Calcium 4PROSITE-ProRule annotation1
Metal bindingi357Calcium 5PROSITE-ProRule annotation1
Metal bindingi359Calcium 4PROSITE-ProRule annotation1
Metal bindingi359Calcium 5PROSITE-ProRule annotation1
Metal bindingi359Calcium 6PROSITE-ProRule annotation1
Metal bindingi362Calcium 6PROSITE-ProRule annotation1
Metal bindingi365Calcium 4By similarity1
Metal bindingi365Calcium 6PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding
Biological processExocytosis
LigandCalcium, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43581

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6794361, Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptotagmin-7Curated
Alternative name(s):
IPCA-7
Prostate cancer-associated protein 7
Synaptotagmin VII
Short name:
SytVII
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYT7Imported
Synonyms:PCANAP7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11514, SYT7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604146, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43581

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000011347.9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 16VesicularSequence analysisAdd BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei17 – 37HelicalSequence analysisAdd BLAST21
Topological domaini38 – 403CytoplasmicSequence analysisAdd BLAST366

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Lysosome, Membrane, Peroxisome, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9066

Open Targets

More...OpenTargetsi		ENSG00000011347

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36295

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43581, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SYT7

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001839571 – 403Synaptotagmin-7Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52PhosphoserineBy similarity1
Modified residuei58PhosphothreonineBy similarity1
Modified residuei61PhosphoserineBy similarity1
Modified residuei119PhosphoserineBy similarity1
Modified residuei122PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated at its vesicular N-terminus; palmitoylation is required for localization to lysosome and phagocytosis in macrophages.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43581

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43581

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43581

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43581

PeptideAtlas

More...PeptideAtlasi		O43581

PRoteomics IDEntifications database

More...PRIDEi		O43581

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		24992
25136
25521
25708
27141
49062 [O43581-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43581

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43581

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a variety of adult and fetal tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000011347, Expressed in islet of Langerhans and 147 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43581, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43581, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000011347, Tissue enhanced (brain, prostate, salivary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Can also form heterodimers with SYT6, SYT9 and SYT10.

Interacts with calmodulin (CALM1, CALM2 or CALM3).

Interacts with CD63; required for localization to lysosomes.

Interacts with APP (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114525, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O43581

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		O43581

Protein interaction database and analysis system

More...IntActi		O43581, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000444201

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43581, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1403
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43581

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O43581

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini135 – 255C2 1PROSITE-ProRule annotationAdd BLAST121
Domaini266 – 399C2 2PROSITE-ProRule annotationAdd BLAST134

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C2 domains bind Ca2+ and membranes. Binding to membranes involves Ca2+-dependent phospholipid binding. Compared to other members of the family, the C2 domains of SYT7 dock and insert into cellular membranes in response to intracellular Ca2+ concentrations that are lower than those required for other synaptotagmins (PubMed:22966849). The two C2 domains bind independently to planar membranes, without interdomain cooperativity (PubMed:25437758). Moreover, SYT7 C2 domains insert more deeply into membranes compared to other synaptotagmins (PubMed:26322740, PubMed:26333120).4 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptotagmin family.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1028, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157180

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_023008_7_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43581

Identification of Orthologs from Complete Genome Data

More...OMAi		WCQRRLG

Database of Orthologous Groups

More...OrthoDBi		925064at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43581

TreeFam database of animal gene trees

More...TreeFami		TF315600

Family and domain databases

Conserved Domains Database

More...CDDi		cd08386, C2A_Synaptotagmin-7, 1 hit
cd08405, C2B_Synaptotagmin-7, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.150, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR037732, C2A_Synaptotagmin-7
IPR037741, C2B_Synaptotagmin-7
IPR001565, Synaptotagmin
IPR015427, Synaptotagmin7

The PANTHER Classification System

More...PANTHERi		PTHR10024:SF358, PTHR10024:SF358, 2 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00168, C2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00360, C2DOMAIN
PR00399, SYNAPTOTAGMN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00239, C2, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50004, C2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43581-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYRDPEAASP GAPSRDVLLV SAIITVSLSV TVVLCGLCHW CQRKLGKRYK 
        60         70         80         90        100
NSLETVGTPD SGRGRSEKKA IKLPAGGKAV NTAPVPGQTP HDESDRRTEP 
       110        120        130        140        150
RSSVSDLVNS LTSEMLMLSP GSEEDEAHEG CSRENLGRIQ FSVGYNFQES 
       160        170        180        190        200
TLTVKIMKAQ ELPAKDFSGT SDPFVKIYLL PDKKHKLETK VKRKNLNPHW 
       210        220        230        240        250
NETFLFEGFP YEKVVQRILY LQVLDYDRFS RNDPIGEVSI PLNKVDLTQM 
       260        270        280        290        300
QTFWKDLKPC SDGSGSRGEL LLSLCYNPSA NSIIVNIIKA RNLKAMDIGG 
       310        320        330        340        350
TSDPYVKVWL MYKDKRVEKK KTVTMKRNLN PIFNESFAFD IPTEKLRETT 
       360        370        380        390        400
IIITVMDKDK LSRNDVIGKI YLSWKSGPGE VKHWKDMIAR PRQPVAQWHQ 

LKA
Note: Major isoform.1 Publication
Length:403
Mass (Da):45,501
Last modified:September 23, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC9BFB26D298EDBE4
GO
Isoform 2 (identifier: O43581-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: I → INGTLLSGAK...HLAAGKLNLS

Show »
Length:478
Mass (Da):52,821
Checksum:i6F6B1DD2C9AFF15F
GO
Isoform 3 (identifier: O43581-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: K → NDLDRDFWNN...QNQNAQGDKR

Show »
Length:686
Mass (Da):75,797
Checksum:i96C75AAD8D9CCBFB
GO
Isoform 4 (identifier: O43581-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: K → NDLDRDFWNN...QNQNAQGDKR

Show »
Length:611
Mass (Da):68,478
Checksum:i68702B2463439DB6
GO
Isoform 5 (identifier: O43581-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: I → INDLDRDFWN...HLAAGKLNLS

Show »
Length:522
Mass (Da):58,019
Checksum:iDFA24AF0D17AD221
GO
Isoform 6 (identifier: O43581-6) [UniParc]FASTAAdd to basket
Also known as: Synaptotagmin VIIbeta1 Publication, Syt7betaCurated

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: I → INDLDRDFWNNNESTVQQKWSSYPPKEFILNISPYAPYGDPRLSL

Show »
Length:447
Mass (Da):50,700
Checksum:i70A51A39F51AFB7F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H8G7F5H8G7_HUMAN
Synaptotagmin-7
SYT7
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GX00F5GX00_HUMAN
Synaptotagmin-7
SYT7
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB92667 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti154V → L in AAB92667 (PubMed:9615227).Curated1
Sequence conflicti188E → K in AAB92667 (PubMed:9615227).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052241332I → N1 PublicationCorresponds to variant dbSNP:rs407740Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04599171I → INGTLLSGAKVAAAAGLAVE REGRLGEKPAPVPPPGEDAL RSGGAAPSEPGSGGKAGRGR WRTVQSHLAAGKLNLS in isoform 2. 1 Publication1
Alternative sequenceiVSP_05823171I → INDLDRDFWNNNESTVQQKW SSYPPKEFILNISPYAPYGD PRLSLNGTLLSGAKVAAAAG LAVEREGRLGEKPAPVPPPG EDALRSGGAAPSEPGSGGKA GRGRWRTVQSHLAAGKLNLS in isoform 5. 1
Alternative sequenceiVSP_05823271I → INDLDRDFWNNNESTVQQKW SSYPPKEFILNISPYAPYGD PRLSL in isoform 6. 1
Alternative sequenceiVSP_05823372K → NDLDRDFWNNNESTVQQKWS SYPPKEFILNISPYAPYGDP RLSLNGTLLSGAKVAAAAGL AVEREGRLGEKPAPVPPPGE DALRSGGAAPSEPGSGGKAG RGRWRTVQSHLAAGKLNLSN FEDSTLSTATTLESIPSSTG EPKCQRPRTLMRQQSLQQPL SQHQRGRQPSQPTTSQSLGQ LQAHMASAPGPNPRAYGRGQ ARQGTSAGSKYRAAGGRSRS NPGSWDHVVGQIRNRGLDMK SFLEGRMVVLSLVLGLSEQD DFANIPDLQNPGTQQNQNAQ GDKR in isoform 3. 1
Alternative sequenceiVSP_05823472K → NDLDRDFWNNNESTVQQKWS SYPPKEFILNISPYAPYGDP RLSLNFEDSTLSTATTLESI PSSTGEPKCQRPRTLMRQQS LQQPLSQHQRGRQPSQPTTS QSLGQLQAHMASAPGPNPRA YGRGQARQGTSAGSKYRAAG GRSRSNPGSWDHVVGQIRNR GLDMKSFLEGRMVVLSLVLG LSEQDDFANIPDLQNPGTQQ NQNAQGDKR in isoform 4. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF038535 mRNA Translation: AAB92667.1 Frameshift.
AP002754 Genomic DNA No translation available.
AP003108 Genomic DNA No translation available.
AP003559 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW73956.1
BC125170 mRNA Translation: AAI25171.1
BC125171 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31577.1 [O43581-1]
CCDS58139.1 [O43581-2]
CCDS73298.1 [O43581-6]

NCBI Reference Sequences

More...RefSeqi		NP_001238994.1, NM_001252065.1 [O43581-2]
NP_001287702.1, NM_001300773.1 [O43581-6]
NP_004191.2, NM_004200.3 [O43581-1]
XP_005274440.1, XM_005274383.4
XP_005274442.1, XM_005274385.4 [O43581-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000263846; ENSP00000263846; ENSG00000011347 [O43581-1]
ENST00000535826; ENSP00000437720; ENSG00000011347 [O43581-5]
ENST00000539008; ENSP00000439694; ENSG00000011347 [O43581-3]
ENST00000540677; ENSP00000444201; ENSG00000011347 [O43581-2]
ENST00000542670; ENSP00000444019; ENSG00000011347 [O43581-4]
ENST00000542836; ENSP00000444568; ENSG00000011347 [O43581-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9066

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9066

UCSC genome browser

More...UCSCi		uc001nrv.4, human [O43581-1]
uc001nrx.2, human
uc058cdk.1, human
uc058cdl.1, human
uc058cdm.1, human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF038535 mRNA Translation: AAB92667.1 Frameshift.
AP002754 Genomic DNA No translation available.
AP003108 Genomic DNA No translation available.
AP003559 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW73956.1
BC125170 mRNA Translation: AAI25171.1
BC125171 mRNA No translation available.
CCDSiCCDS31577.1 [O43581-1]
CCDS58139.1 [O43581-2]
CCDS73298.1 [O43581-6]
RefSeqiNP_001238994.1, NM_001252065.1 [O43581-2]
NP_001287702.1, NM_001300773.1 [O43581-6]
NP_004191.2, NM_004200.3 [O43581-1]
XP_005274440.1, XM_005274383.4
XP_005274442.1, XM_005274385.4 [O43581-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D8KNMR-A132-259[»]
SMRiO43581
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114525, 10 interactors
CORUMiO43581
ELMiO43581
IntActiO43581, 4 interactors
STRINGi9606.ENSP00000444201

PTM databases

iPTMnetiO43581
PhosphoSitePlusiO43581

Genetic variation databases

BioMutaiSYT7

Proteomic databases

jPOSTiO43581
MassIVEiO43581
MaxQBiO43581
PaxDbiO43581
PeptideAtlasiO43581
PRIDEiO43581
ProteomicsDBi24992
25136
25521
25708
27141
49062 [O43581-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2220, 248 antibodies

Genome annotation databases

EnsembliENST00000263846; ENSP00000263846; ENSG00000011347 [O43581-1]
ENST00000535826; ENSP00000437720; ENSG00000011347 [O43581-5]
ENST00000539008; ENSP00000439694; ENSG00000011347 [O43581-3]
ENST00000540677; ENSP00000444201; ENSG00000011347 [O43581-2]
ENST00000542670; ENSP00000444019; ENSG00000011347 [O43581-4]
ENST00000542836; ENSP00000444568; ENSG00000011347 [O43581-6]
GeneIDi9066
KEGGihsa:9066
UCSCiuc001nrv.4, human [O43581-1]
uc001nrx.2, human
uc058cdk.1, human
uc058cdl.1, human
uc058cdm.1, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9066
DisGeNETi9066

GeneCards: human genes, protein and diseases

More...GeneCardsi		SYT7
HGNCiHGNC:11514, SYT7
HPAiENSG00000011347, Tissue enhanced (brain, prostate, salivary gland)
MIMi604146, gene
neXtProtiNX_O43581
OpenTargetsiENSG00000011347
PharmGKBiPA36295
VEuPathDBiHostDB:ENSG00000011347.9

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1028, Eukaryota
GeneTreeiENSGT00940000157180
HOGENOMiCLU_023008_7_2_1
InParanoidiO43581
OMAiWCQRRLG
OrthoDBi925064at2759
PhylomeDBiO43581
TreeFamiTF315600

Enzyme and pathway databases

PathwayCommonsiO43581
ReactomeiR-HSA-6794361, Neurexins and neuroligins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9066, 6 hits in 873 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SYT7, human
EvolutionaryTraceiO43581

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SYT7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9066
PharosiO43581, Tbio

Protein Ontology

More...PROi		PR:O43581
RNActiO43581, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000011347, Expressed in islet of Langerhans and 147 other tissues
ExpressionAtlasiO43581, baseline and differential
GenevisibleiO43581, HS

Family and domain databases

CDDicd08386, C2A_Synaptotagmin-7, 1 hit
cd08405, C2B_Synaptotagmin-7, 1 hit
Gene3Di2.60.40.150, 2 hits
InterProiView protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR037732, C2A_Synaptotagmin-7
IPR037741, C2B_Synaptotagmin-7
IPR001565, Synaptotagmin
IPR015427, Synaptotagmin7
PANTHERiPTHR10024:SF358, PTHR10024:SF358, 2 hits
PfamiView protein in Pfam
PF00168, C2, 2 hits
PRINTSiPR00360, C2DOMAIN
PR00399, SYNAPTOTAGMN
SMARTiView protein in SMART
SM00239, C2, 2 hits
PROSITEiView protein in PROSITE
PS50004, C2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYT7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43581
Secondary accession number(s): F5GZC2
, F5GZU9, F5H126, F5H1N2, F5H6C1, Q08AH6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: September 23, 2008
Last modified: February 10, 2021
This is version 183 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  6. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again