Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Linker for activation of T-cells family member 1

Gene

LAT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.1 Publication

Miscellaneous

Engagement of killer inhibitory receptors (KIR) disrupts the interaction of PLCG1 with LAT and blocks target cell-induced activation of PLC, maybe by inducing the dephosphorylation of LAT.

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB
  • Ras guanyl-nucleotide exchange factor activity Source: Reactome
  • SH3/SH2 adaptor activity Source: HGNC

GO - Biological processi

Keywordsi

Biological processAdaptive immunity, Immunity, Mast cell degranulation

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade
R-HSA-202433 Generation of second messenger molecules
R-HSA-2424491 DAP12 signaling
R-HSA-2454202 Fc epsilon receptor (FCERI) signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5673001 RAF/MAP kinase cascade
SignaLinkiO43561
SIGNORiO43561

Names & Taxonomyi

Protein namesi
Recommended name:
Linker for activation of T-cells family member 1
Alternative name(s):
36 kDa phospho-tyrosine adapter protein
Short name:
pp36
p36-38
Gene namesi
Name:LAT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000213658.10
HGNCiHGNC:18874 LAT
MIMi602354 gene
neXtProtiNX_O43561

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4ExtracellularSequence analysis4
Transmembranei5 – 27Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini28 – 262CytoplasmicSequence analysisAdd BLAST235

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Immunodeficiency 52 (IMD52)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive primary immunodeficiency characterized by T-cell abnormalities, resulting in severe combined immunodeficiency, autoimmune disease, progressive lymphopenia and hypogammaglobulinemia, and lymphoproliferation with splenomegaly. Patients develop severe recurrent infections from infancy.
See also OMIM:617514

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi26C → A: Reduces palmitoylation; abolishes localization to lipid rafts. 1 Publication1
Mutagenesisi29C → A: Reduces palmitoylation; impairs localization to lipid rafts. 1 Publication1
Mutagenesisi161Y → F: Abolishes interaction with PLCG1. 1 Publication1
Mutagenesisi200Y → F: Abolishes interaction with GRB2 and PIK3R1; when associated with F-220. 1 Publication1
Mutagenesisi220Y → F: Abolishes interaction with GRB2 and PIK3R1; when associated with F-200. 1 Publication1

Organism-specific databases

DisGeNETi27040
MalaCardsiLAT
MIMi617514 phenotype
OpenTargetsiENSG00000213658
Orphaneti504523 Severe combined immunodeficiency due to LAT deficiency
PharmGKBiPA38728

Chemistry databases

ChEMBLiCHEMBL5779

Polymorphism and mutation databases

BioMutaiLAT

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000833251 – 262Linker for activation of T-cells family member 1Add BLAST262

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi26S-palmitoyl cysteine1 Publication1
Lipidationi29S-palmitoyl cysteine1 Publication1
Modified residuei39PhosphothreonineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei41PhosphoserineCombined sources1
Modified residuei43PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei106PhosphoserineCombined sources1
Modified residuei109PhosphoserineBy similarity1
Modified residuei110PhosphotyrosineCurated1
Modified residuei156PhosphotyrosineCurated1
Modified residuei161PhosphotyrosineCurated1
Modified residuei200Phosphotyrosine1 Publication1
Modified residuei220PhosphotyrosineCurated1
Modified residuei224PhosphoserineCombined sources1
Modified residuei240PhosphoserineCombined sources1
Modified residuei241PhosphoserineCombined sources1
Modified residuei255PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes.
Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiO43561
PeptideAtlasiO43561
PRIDEiO43561
ProteomicsDBi49052
49053 [O43561-2]

PTM databases

iPTMnetiO43561
PhosphoSitePlusiO43561
SwissPalmiO43561

Expressioni

Tissue specificityi

Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000213658 Expressed in 92 organ(s), highest expression level in leukocyte
CleanExiHS_LAT
ExpressionAtlasiO43561 baseline and differential
GenevisibleiO43561 HS

Organism-specific databases

HPAiCAB002223
CAB012978
HPA011157

Interactioni

Subunit structurei

When phosphorylated, interacts directly with the PIK3R1 subunit of phosphoinositide 3-kinase and the SH2 domains of GRB2, GRAP, GRAP2, PLCG1 and PLCG2. Interacts indirectly with CBL, SOS, VAV, and LCP2. Interacts with SHB, SKAP2 and CLNK (By similarity). Interacts with FCGR1A. Interacts with GRB2, PLCG1 and THEMIS upon TCR activation in thymocytes (By similarity).By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117971, 40 interactors
CORUMiO43561
DIPiDIP-29231N
IntActiO43561, 73 interactors
MINTiO43561

Structurei

3D structure databases

ProteinModelPortaliO43561
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni161 – 164Interaction with PLCG14
Regioni200 – 203Interaction with GRB2, GRAP2 and PIK3R11 Publication4
Regioni220 – 223Interaction with GRB2, GRAP2 and PIK3R11 Publication4

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000014223
HOGENOMiHOG000081810
HOVERGENiHBG018198
InParanoidiO43561
KOiK07362
OMAiQAGWGVW
OrthoDBiEOG091G0QKO
PhylomeDBiO43561
TreeFamiTF337741

Family and domain databases

InterProiView protein in InterPro
IPR008359 Linker_for_activat_Tcells_prot
PANTHERiPTHR15586 PTHR15586, 1 hit
PfamiView protein in Pfam
PF15234 LAT, 1 hit
PRINTSiPR01781 LATPROTEIN

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43561-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEAILVPCV LGLLLLPILA MLMALCVHCH RLPGSYDSTS SDSLYPRGIQ
60 70 80 90 100
FKRPHTVAPW PPAYPPVTSY PPLSQPDLLP IPRSPQPLGG SHRTPSSRRD
110 120 130 140 150
SDGANSVASY ENEGASGIRG AQAGWGVWGP SWTRLTPVSL PPEPACEDAD
160 170 180 190 200
EDEDDYHNPG YLVVLPDSTP ATSTAAPSAP ALSTPGIRDS AFSMESIDDY
210 220 230 240 250
VNVPESGESA EASLDGSREY VNVSQELHPG AAKTEPAALS SQEAEEVEEE
260
GAPDYENLQE LN
Length:262
Mass (Da):27,930
Last modified:June 1, 1998 - v1
Checksum:iBCD80AE7DCA64153
GO
Isoform 2 (identifier: O43561-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     114-142: Missing.

Show »
Length:233
Mass (Da):24,985
Checksum:i0832E2D2B4220BC6
GO
Isoform 3 (identifier: O43561-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM
     114-142: Missing.

Note: Gene prediction based on EST data.
Show »
Length:269
Mass (Da):28,568
Checksum:i00A1E5FD10A258FE
GO
Isoform 4 (identifier: O43561-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: Missing.
     114-142: Missing.

Show »
Length:232
Mass (Da):24,829
Checksum:iAFA91E716FEBE1CE
GO
Isoform 5 (identifier: O43561-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: Missing.

Show »
Length:261
Mass (Da):27,774
Checksum:i0108E1F423BFE30E
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BQD8H3BQD8_HUMAN
Linker for activation of T-cells fa...
LAT
166Annotation score:
C7C5T5C7C5T5_HUMAN
Linker for activation of T-cells fa...
LAT
85Annotation score:
A0A1W2PQT7A0A1W2PQT7_HUMAN
Linker for activation of T-cells fa...
LAT
252Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0547581M → MEATAASWQVAVPVLGGASR PLGPRGAASLLRAPLQM in isoform 3. Curated1
Alternative sequenceiVSP_05475983Missing in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_004303114 – 142Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF036906 mRNA Translation: AAC39637.1
AF036905 mRNA Translation: AAC39636.1
AJ223280 mRNA Translation: CAA11218.1
FN432832 mRNA Translation: CBA11533.1
AC109460 Genomic DNA No translation available.
CH471267 Genomic DNA Translation: EAW52027.1
CH471267 Genomic DNA Translation: EAW52028.1
BC011563 mRNA Translation: AAH11563.1
CCDSiCCDS10647.1 [O43561-1]
CCDS32425.1 [O43561-2]
CCDS45455.1 [O43561-4]
CCDS53999.1 [O43561-3]
RefSeqiNP_001014987.1, NM_001014987.1 [O43561-2]
NP_001014988.1, NM_001014988.1 [O43561-4]
NP_001014989.2, NM_001014989.1 [O43561-3]
NP_055202.1, NM_014387.3 [O43561-1]
UniGeneiHs.632179

Genome annotation databases

EnsembliENST00000360872; ENSP00000354119; ENSG00000213658 [O43561-1]
ENST00000395456; ENSP00000378841; ENSG00000213658 [O43561-2]
ENST00000395461; ENSP00000378845; ENSG00000213658 [O43561-3]
ENST00000454369; ENSP00000398793; ENSG00000213658 [O43561-4]
ENST00000564277; ENSP00000457036; ENSG00000213658 [O43561-4]
ENST00000566177; ENSP00000456761; ENSG00000213658 [O43561-5]
GeneIDi27040
KEGGihsa:27040
UCSCiuc002dsb.4 human [O43561-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF036906 mRNA Translation: AAC39637.1
AF036905 mRNA Translation: AAC39636.1
AJ223280 mRNA Translation: CAA11218.1
FN432832 mRNA Translation: CBA11533.1
AC109460 Genomic DNA No translation available.
CH471267 Genomic DNA Translation: EAW52027.1
CH471267 Genomic DNA Translation: EAW52028.1
BC011563 mRNA Translation: AAH11563.1
CCDSiCCDS10647.1 [O43561-1]
CCDS32425.1 [O43561-2]
CCDS45455.1 [O43561-4]
CCDS53999.1 [O43561-3]
RefSeqiNP_001014987.1, NM_001014987.1 [O43561-2]
NP_001014988.1, NM_001014988.1 [O43561-4]
NP_001014989.2, NM_001014989.1 [O43561-3]
NP_055202.1, NM_014387.3 [O43561-1]
UniGeneiHs.632179

3D structure databases

ProteinModelPortaliO43561
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117971, 40 interactors
CORUMiO43561
DIPiDIP-29231N
IntActiO43561, 73 interactors
MINTiO43561

Chemistry databases

ChEMBLiCHEMBL5779

PTM databases

iPTMnetiO43561
PhosphoSitePlusiO43561
SwissPalmiO43561

Polymorphism and mutation databases

BioMutaiLAT

Proteomic databases

MaxQBiO43561
PeptideAtlasiO43561
PRIDEiO43561
ProteomicsDBi49052
49053 [O43561-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360872; ENSP00000354119; ENSG00000213658 [O43561-1]
ENST00000395456; ENSP00000378841; ENSG00000213658 [O43561-2]
ENST00000395461; ENSP00000378845; ENSG00000213658 [O43561-3]
ENST00000454369; ENSP00000398793; ENSG00000213658 [O43561-4]
ENST00000564277; ENSP00000457036; ENSG00000213658 [O43561-4]
ENST00000566177; ENSP00000456761; ENSG00000213658 [O43561-5]
GeneIDi27040
KEGGihsa:27040
UCSCiuc002dsb.4 human [O43561-1]

Organism-specific databases

CTDi27040
DisGeNETi27040
EuPathDBiHostDB:ENSG00000213658.10
GeneCardsiLAT
HGNCiHGNC:18874 LAT
HPAiCAB002223
CAB012978
HPA011157
MalaCardsiLAT
MIMi602354 gene
617514 phenotype
neXtProtiNX_O43561
OpenTargetsiENSG00000213658
Orphaneti504523 Severe combined immunodeficiency due to LAT deficiency
PharmGKBiPA38728
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000014223
HOGENOMiHOG000081810
HOVERGENiHBG018198
InParanoidiO43561
KOiK07362
OMAiQAGWGVW
OrthoDBiEOG091G0QKO
PhylomeDBiO43561
TreeFamiTF337741

Enzyme and pathway databases

ReactomeiR-HSA-114604 GPVI-mediated activation cascade
R-HSA-202433 Generation of second messenger molecules
R-HSA-2424491 DAP12 signaling
R-HSA-2454202 Fc epsilon receptor (FCERI) signaling
R-HSA-2871796 FCERI mediated MAPK activation
R-HSA-2871809 FCERI mediated Ca+2 mobilization
R-HSA-5673001 RAF/MAP kinase cascade
SignaLinkiO43561
SIGNORiO43561

Miscellaneous databases

GeneWikiiLinker_of_activated_T_cells
GenomeRNAii27040
PROiPR:O43561
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000213658 Expressed in 92 organ(s), highest expression level in leukocyte
CleanExiHS_LAT
ExpressionAtlasiO43561 baseline and differential
GenevisibleiO43561 HS

Family and domain databases

InterProiView protein in InterPro
IPR008359 Linker_for_activat_Tcells_prot
PANTHERiPTHR15586 PTHR15586, 1 hit
PfamiView protein in Pfam
PF15234 LAT, 1 hit
PRINTSiPR01781 LATPROTEIN
ProtoNetiSearch...

Entry informationi

Entry nameiLAT_HUMAN
AccessioniPrimary (citable) accession number: O43561
Secondary accession number(s): B7WPI0
, C7C5T6, G5E9K3, O43919
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 1998
Last modified: November 7, 2018
This is version 173 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again