Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43561 (LAT_HUMAN)

Entry version 189 (10 Feb 2021)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Linker for activation of T-cells family member 1

Gene

LAT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.1 Publication

Miscellaneous

Engagement of killer inhibitory receptors (KIR) disrupts the interaction of PLCG1 with LAT and blocks target cell-induced activation of PLC, maybe by inducing the dephosphorylation of LAT.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAdaptive immunity, Immunity, Mast cell degranulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43561

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-114604, GPVI-mediated activation cascade
R-HSA-202433, Generation of second messenger molecules
R-HSA-2424491, DAP12 signaling [O43561-2]
R-HSA-2454202, Fc epsilon receptor (FCERI) signaling [O43561-2]
R-HSA-2871796, FCERI mediated MAPK activation [O43561-2]
R-HSA-2871809, FCERI mediated Ca+2 mobilization [O43561-2]
R-HSA-5673001, RAF/MAP kinase cascade [O43561-2]

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O43561

SIGNOR Signaling Network Open Resource

More...SIGNORi		O43561

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Linker for activation of T-cells family member 1
Alternative name(s):
36 kDa phospho-tyrosine adapter protein
Short name:
pp36
p36-38
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LAT
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18874, LAT

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602354, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43561

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000213658.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 4ExtracellularSequence analysis4
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei5 – 27Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST23
Topological domaini28 – 262CytoplasmicSequence analysisAdd BLAST235

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency 52 (IMD52)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive primary immunodeficiency characterized by T-cell abnormalities, resulting in severe combined immunodeficiency, autoimmune disease, progressive lymphopenia and hypogammaglobulinemia, and lymphoproliferation with splenomegaly. Patients develop severe recurrent infections from infancy.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi26C → A: Reduces palmitoylation; abolishes localization to lipid rafts. 1 Publication1
Mutagenesisi29C → A: Reduces palmitoylation; impairs localization to lipid rafts. 1 Publication1
Mutagenesisi161Y → F: Abolishes interaction with PLCG1. 1 Publication1
Mutagenesisi200Y → F: Abolishes interaction with GRB2 and PIK3R1; when associated with F-220. 1 Publication1
Mutagenesisi220Y → F: Abolishes interaction with GRB2 and PIK3R1; when associated with F-200. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		27040

MalaCards human disease database

More...MalaCardsi		LAT
MIMi617514, phenotype

Open Targets

More...OpenTargetsi		ENSG00000213658

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		504523, Severe combined immunodeficiency due to LAT deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38728

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43561, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5779

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LAT

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000833251 – 262Linker for activation of T-cells family member 1Add BLAST262

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi26S-palmitoyl cysteine1 Publication1
Lipidationi29S-palmitoyl cysteine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei39PhosphothreonineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei41PhosphoserineCombined sources1
Modified residuei43PhosphoserineCombined sources1
Modified residuei84PhosphoserineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei106PhosphoserineCombined sources1
Modified residuei109PhosphoserineBy similarity1
Modified residuei110PhosphotyrosineCurated1
Modified residuei156PhosphotyrosineCurated1
Modified residuei161PhosphotyrosineCurated1
Modified residuei200Phosphotyrosine1 Publication1
Modified residuei220PhosphotyrosineCurated1
Modified residuei224PhosphoserineCombined sources1
Modified residuei240PhosphoserineCombined sources1
Modified residuei241PhosphoserineCombined sources1
Modified residuei255PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes.
Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43561

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43561

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43561

PeptideAtlas

More...PeptideAtlasi		O43561

PRoteomics IDEntifications database

More...PRIDEi		O43561

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		33964
49052 [O43561-1]
49053 [O43561-2]
6302
7609

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O43561, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43561

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43561

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O43561

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000213658, Expressed in granulocyte and 118 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43561, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43561, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000213658, Group enriched (blood, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

When phosphorylated, interacts directly with the PIK3R1 subunit of phosphoinositide 3-kinase and the SH2 domains of GRB2, GRAP, GRAP2, PLCG1 and PLCG2.

Interacts indirectly with CBL, SOS, VAV, and LCP2.

Interacts with SHB, SKAP2 and CLNK (By similarity).

Interacts with FCGR1A.

Interacts with GRB2, PLCG1 and THEMIS upon TCR activation in thymocytes (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

O43561
With#Exp.IntAct
EGFR [P00533]3EBI-1222766,EBI-297353
GRB2 [P62993]7EBI-1222766,EBI-401755
LCK [P06239]2EBI-1222766,EBI-1348
PIK3R1 [P27986]4EBI-1222766,EBI-79464
PLCG1 [P19174]7EBI-1222766,EBI-79387
PTPN1 [P18031]3EBI-1222766,EBI-968788
SGTA [O43765]3EBI-1222766,EBI-347996
Isoform 2 [O43561-2]
With#Exp.IntAct
APH1A [Q96BI3]3EBI-8070286,EBI-2606935
ASGR2 - isoform 3 [P07307-3]3EBI-8070286,EBI-12808270
BCL2L13 [Q9BXK5]3EBI-8070286,EBI-747430
BSCL2 [J3KQ12]3EBI-8070286,EBI-11532900
CAMLG [P49069]3EBI-8070286,EBI-1748958
CD3G [P09693]3EBI-8070286,EBI-3862428
CD53 [P19397]3EBI-8070286,EBI-6657396
CDIP1 [Q9H305]3EBI-8070286,EBI-2876678
CLDN2 [P57739]3EBI-8070286,EBI-751440
CLDN5 [O00501]3EBI-8070286,EBI-18400628
CLDN7 [O95471]3EBI-8070286,EBI-740744
CXorf66 [Q5JRM2]3EBI-8070286,EBI-12823659
CYBC1 [Q9BQA9]3EBI-8070286,EBI-2680384
FFAR2 [O15552]3EBI-8070286,EBI-2833872
FFAR3 [O14843]3EBI-8070286,EBI-17762181
FKBP7 [Q9Y680]3EBI-8070286,EBI-3918971
GJA8 [P48165]3EBI-8070286,EBI-17458373
GJB1 [P08034]3EBI-8070286,EBI-17565645
GJB3 [O75712]3EBI-8070286,EBI-3908586
GOLM1 [Q8NBJ4]3EBI-8070286,EBI-712073
GPR101 [Q96P66]3EBI-8070286,EBI-17935713
GPR151 [Q8TDV0]3EBI-8070286,EBI-11955647
GPR152 [Q8TDT2]3EBI-8070286,EBI-13345167
GPR42 [O15529]3EBI-8070286,EBI-18076404
GRB2 - isoform 1 [P62993-1]3EBI-8070286,EBI-15787932
JSRP1 [Q96MG2]3EBI-8070286,EBI-11305455
KCTD17 [Q8N5Z5]3EBI-8070286,EBI-743960
KIR2DL3 [P43628]3EBI-8070286,EBI-8632435
LEUTX [A8MZ59]3EBI-8070286,EBI-17490413
LHFPL1 [Q86WI0]3EBI-8070286,EBI-18268016
LHFPL5 [Q8TAF8]3EBI-8070286,EBI-2820517
MAP1LC3C [Q9BXW4]3EBI-8070286,EBI-2603996
MEOX2 [Q6FHY5]3EBI-8070286,EBI-16439278
MFF - isoform 5 [Q9GZY8-5]3EBI-8070286,EBI-11956541
MFSD14B [Q5SR56]3EBI-8070286,EBI-373355
MFSD5 [Q6N075]3EBI-8070286,EBI-3920969
MRPS18B [Q9Y676]3EBI-8070286,EBI-750085
MS4A7 [Q9GZW8]3EBI-8070286,EBI-721391
MTIF3 [Q9H2K0]3EBI-8070286,EBI-3923617
NDUFAF2 [Q8N183]3EBI-8070286,EBI-2682365
OPRM1 - isoform 10 [P35372-10]3EBI-8070286,EBI-12807478
PRR4 [Q16378]3EBI-8070286,EBI-738624
SAR1A [Q9NR31]3EBI-8070286,EBI-3920694
SGTA [O43765]3EBI-8070286,EBI-347996
SGTB [Q96EQ0]3EBI-8070286,EBI-744081
SLC14A2 [Q15849]3EBI-8070286,EBI-1573290
SLC18A1 - isoform 3 [P54219-3]3EBI-8070286,EBI-17595455
SLC19A3 [Q9BZV2]3EBI-8070286,EBI-3923779
SLC26A6 - isoform 3 [Q9BXS9-3]3EBI-8070286,EBI-12814225
SLC35C2 - isoform 3 [Q9NQQ7-3]3EBI-8070286,EBI-17295964
SLC51B [Q86UW2]5EBI-8070286,EBI-12266756
SLPI [P03973]3EBI-8070286,EBI-355293
SSMEM1 [Q8WWF3]3EBI-8070286,EBI-17280858
SYT2 [Q8N9I0]3EBI-8070286,EBI-8032987
THAP4 [Q8WY91]3EBI-8070286,EBI-726691
TM4SF18 [Q96CE8]3EBI-8070286,EBI-13351685
TMEM237 - isoform 2 [Q96Q45-2]3EBI-8070286,EBI-10982110
TMEM45B [Q96B21]3EBI-8070286,EBI-3923061
TMEM80 [Q96HE8]3EBI-8070286,EBI-11742770
TNFRSF10D [Q9UBN6]3EBI-8070286,EBI-1044859
ZDHHC7 - isoform 2 [Q9NXF8-2]3EBI-8070286,EBI-12948063
PLCG1 [P08487] from Bos taurus.4EBI-8070286,EBI-8013886

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117971, 104 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O43561

Database of interacting proteins

More...DIPi		DIP-29231N

Protein interaction database and analysis system

More...IntActi		O43561, 80 interactors

Molecular INTeraction database

More...MINTi		O43561

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43561, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni161 – 164Interaction with PLCG14
Regioni200 – 203Interaction with GRB2, GRAP2 and PIK3R11 Publication4
Regioni220 – 223Interaction with GRB2, GRAP2 and PIK3R11 Publication4

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00390000014223

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_093883_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43561

Identification of Orthologs from Complete Genome Data

More...OMAi		WGPSWAR

Database of Orthologous Groups

More...OrthoDBi		1328822at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43561

TreeFam database of animal gene trees

More...TreeFami		TF337741

Family and domain databases

Database of protein disorder

More...DisProti		DP01126

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008359, Linker_for_activat_Tcells_prot

The PANTHER Classification System

More...PANTHERi		PTHR15586, PTHR15586, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15234, LAT, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01781, LATPROTEIN

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43561-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEAILVPCV LGLLLLPILA MLMALCVHCH RLPGSYDSTS SDSLYPRGIQ 
        60         70         80         90        100
FKRPHTVAPW PPAYPPVTSY PPLSQPDLLP IPRSPQPLGG SHRTPSSRRD 
       110        120        130        140        150
SDGANSVASY ENEGASGIRG AQAGWGVWGP SWTRLTPVSL PPEPACEDAD 
       160        170        180        190        200
EDEDDYHNPG YLVVLPDSTP ATSTAAPSAP ALSTPGIRDS AFSMESIDDY 
       210        220        230        240        250
VNVPESGESA EASLDGSREY VNVSQELHPG AAKTEPAALS SQEAEEVEEE 
       260 
GAPDYENLQE LN
Length:262
Mass (Da):27,930
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBCD80AE7DCA64153
GO
Isoform 2 (identifier: O43561-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     114-142: Missing.

Show »
Length:233
Mass (Da):24,985
Checksum:i0832E2D2B4220BC6
GO
Isoform 3 (identifier: O43561-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEATAASWQVAVPVLGGASRPLGPRGAASLLRAPLQM
     114-142: Missing.

Show »
Length:269
Mass (Da):28,568
Checksum:i00A1E5FD10A258FE
GO
Isoform 4 (identifier: O43561-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: Missing.
     114-142: Missing.

Show »
Length:232
Mass (Da):24,829
Checksum:iAFA91E716FEBE1CE
GO
Isoform 5 (identifier: O43561-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-83: Missing.

Show »
Length:261
Mass (Da):27,774
Checksum:i0108E1F423BFE30E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PQT7A0A1W2PQT7_HUMAN
Linker for activation of T-cells fa...
LAT
252Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQD8H3BQD8_HUMAN
Linker for activation of T-cells fa...
LAT
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C7C5T5C7C5T5_HUMAN
Linker for activation of T-cells fa...
LAT
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0547581M → MEATAASWQVAVPVLGGASR PLGPRGAASLLRAPLQM in isoform 3. Curated1
Alternative sequenceiVSP_05475983Missing in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_004303114 – 142Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF036906 mRNA Translation: AAC39637.1
AF036905 mRNA Translation: AAC39636.1
AJ223280 mRNA Translation: CAA11218.1
FN432832 mRNA Translation: CBA11533.1
AC109460 Genomic DNA No translation available.
CH471267 Genomic DNA Translation: EAW52027.1
CH471267 Genomic DNA Translation: EAW52028.1
BC011563 mRNA Translation: AAH11563.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10647.1 [O43561-1]
CCDS32425.1 [O43561-2]
CCDS45455.1 [O43561-4]
CCDS53999.1 [O43561-3]

NCBI Reference Sequences

More...RefSeqi		NP_001014987.1, NM_001014987.1 [O43561-2]
NP_001014988.1, NM_001014988.1 [O43561-4]
NP_001014989.2, NM_001014989.1 [O43561-3]
NP_055202.1, NM_014387.3 [O43561-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000360872; ENSP00000354119; ENSG00000213658 [O43561-1]
ENST00000395456; ENSP00000378841; ENSG00000213658 [O43561-2]
ENST00000395461; ENSP00000378845; ENSG00000213658 [O43561-3]
ENST00000454369; ENSP00000398793; ENSG00000213658 [O43561-4]
ENST00000564277; ENSP00000457036; ENSG00000213658 [O43561-4]
ENST00000566177; ENSP00000456761; ENSG00000213658 [O43561-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		27040

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:27040

UCSC genome browser

More...UCSCi		uc002dsb.4, human [O43561-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF036906 mRNA Translation: AAC39637.1
AF036905 mRNA Translation: AAC39636.1
AJ223280 mRNA Translation: CAA11218.1
FN432832 mRNA Translation: CBA11533.1
AC109460 Genomic DNA No translation available.
CH471267 Genomic DNA Translation: EAW52027.1
CH471267 Genomic DNA Translation: EAW52028.1
BC011563 mRNA Translation: AAH11563.1
CCDSiCCDS10647.1 [O43561-1]
CCDS32425.1 [O43561-2]
CCDS45455.1 [O43561-4]
CCDS53999.1 [O43561-3]
RefSeqiNP_001014987.1, NM_001014987.1 [O43561-2]
NP_001014988.1, NM_001014988.1 [O43561-4]
NP_001014989.2, NM_001014989.1 [O43561-3]
NP_055202.1, NM_014387.3 [O43561-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi117971, 104 interactors
CORUMiO43561
DIPiDIP-29231N
IntActiO43561, 80 interactors
MINTiO43561

Chemistry databases

ChEMBLiCHEMBL5779

PTM databases

GlyGeniO43561, 1 site, 1 O-linked glycan (1 site)
iPTMnetiO43561
PhosphoSitePlusiO43561
SwissPalmiO43561

Genetic variation databases

BioMutaiLAT

Proteomic databases

jPOSTiO43561
MassIVEiO43561
MaxQBiO43561
PeptideAtlasiO43561
PRIDEiO43561
ProteomicsDBi33964
49052 [O43561-1]
49053 [O43561-2]
6302
7609

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2621, 984 antibodies

The CPTC Antibody Portal

More...CPTCi		O43561, 1 antibody

Genome annotation databases

EnsembliENST00000360872; ENSP00000354119; ENSG00000213658 [O43561-1]
ENST00000395456; ENSP00000378841; ENSG00000213658 [O43561-2]
ENST00000395461; ENSP00000378845; ENSG00000213658 [O43561-3]
ENST00000454369; ENSP00000398793; ENSG00000213658 [O43561-4]
ENST00000564277; ENSP00000457036; ENSG00000213658 [O43561-4]
ENST00000566177; ENSP00000456761; ENSG00000213658 [O43561-5]
GeneIDi27040
KEGGihsa:27040
UCSCiuc002dsb.4, human [O43561-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		27040
DisGeNETi27040

GeneCards: human genes, protein and diseases

More...GeneCardsi		LAT
HGNCiHGNC:18874, LAT
HPAiENSG00000213658, Group enriched (blood, lymphoid tissue)
MalaCardsiLAT
MIMi602354, gene
617514, phenotype
neXtProtiNX_O43561
OpenTargetsiENSG00000213658
Orphaneti504523, Severe combined immunodeficiency due to LAT deficiency
PharmGKBiPA38728
VEuPathDBiHostDB:ENSG00000213658.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00390000014223
HOGENOMiCLU_093883_0_0_1
InParanoidiO43561
OMAiWGPSWAR
OrthoDBi1328822at2759
PhylomeDBiO43561
TreeFamiTF337741

Enzyme and pathway databases

PathwayCommonsiO43561
ReactomeiR-HSA-114604, GPVI-mediated activation cascade
R-HSA-202433, Generation of second messenger molecules
R-HSA-2424491, DAP12 signaling [O43561-2]
R-HSA-2454202, Fc epsilon receptor (FCERI) signaling [O43561-2]
R-HSA-2871796, FCERI mediated MAPK activation [O43561-2]
R-HSA-2871809, FCERI mediated Ca+2 mobilization [O43561-2]
R-HSA-5673001, RAF/MAP kinase cascade [O43561-2]
SignaLinkiO43561
SIGNORiO43561

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		27040, 9 hits in 878 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LAT, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Linker_of_activated_T_cells

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		27040
PharosiO43561, Tbio

Protein Ontology

More...PROi		PR:O43561
RNActiO43561, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000213658, Expressed in granulocyte and 118 other tissues
ExpressionAtlasiO43561, baseline and differential
GenevisibleiO43561, HS

Family and domain databases

DisProtiDP01126
InterProiView protein in InterPro
IPR008359, Linker_for_activat_Tcells_prot
PANTHERiPTHR15586, PTHR15586, 1 hit
PfamiView protein in Pfam
PF15234, LAT, 1 hit
PRINTSiPR01781, LATPROTEIN

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLAT_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43561
Secondary accession number(s): B7WPI0
, C7C5T6, G5E9K3, O43919
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: June 1, 1998
Last modified: February 10, 2021
This is version 189 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again