Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43521 (B2L11_HUMAN)

Entry version 197 (07 Apr 2021)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Bcl-2-like protein 11

Gene

BCL2L11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43521

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111446, Activation of BIM and translocation to mitochondria
R-HSA-111453, BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-193648, NRAGE signals death through JNK
R-HSA-6802952, Signaling by BRAF and RAF fusions
R-HSA-8862803, Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
R-HSA-8952158, RUNX3 regulates BCL2L11 (BIM) transcription
R-HSA-9607240, FLT3 Signaling
R-HSA-9614657, FOXO-mediated transcription of cell death genes

SIGNOR Signaling Network Open Resource

More...SIGNORi		O43521

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.69.1.1, the pro-apoptotic bcl-2-family protein bim (bim) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bcl-2-like protein 11
Short name:
Bcl2-L-11
Alternative name(s):
Bcl2-interacting mediator of cell death
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCL2L11
Synonyms:BIM
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:994, BCL2L11

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603827, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43521

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000153094.21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi156G → A: Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2. 2 Publications1
Mutagenesisi156G → E: Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX. 2 Publications1
Mutagenesisi160N → A: Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		10018

Open Targets

More...OpenTargetsi		ENSG00000153094

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25305

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43521, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5777

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BCL2L11

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001431091 – 198Bcl-2-like protein 11Add BLAST198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei69Phosphoserine; by MAPK1 Publication1
Modified residuei77PhosphoserineBy similarity1
Modified residuei87PhosphoserineBy similarity1
Modified residuei94PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-69 by MAPK1/MAPK3 leads to interaction with TRIM2 and polyubiquitination, followed by proteasomal degradation (PubMed:15486195, PubMed:21478148). Deubiquitination catalyzed by USP27X stabilizes the protein (By similarity).By similarity2 Publications
Ubiquitination by TRIM2 following phosphorylation by MAPK1/MAPK3 leads to proteasomal degradation. Conversely, deubiquitination catalyzed by USP27X stabilizes the protein.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43521

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43521

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43521

PeptideAtlas

More...PeptideAtlasi		O43521

PRoteomics IDEntifications database

More...PRIDEi		O43521

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		49009 [O43521-1]
49010 [O43521-10]
49011 [O43521-11]
49012 [O43521-12]
49013 [O43521-13]
49014 [O43521-14]
49015 [O43521-15]
49016 [O43521-16]
49017 [O43521-17]
49018 [O43521-18]
49019 [O43521-19]
49020 [O43521-2]
49021 [O43521-20]
49022 [O43521-3]
49023 [O43521-4]
49024 [O43521-5]
49025 [O43521-6]
49026 [O43521-7]
49027 [O43521-8]
49028 [O43521-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43521

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43521

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By ER stress in a DDIT3/CHOP-dependent manner.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000153094, Expressed in sperm and 203 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43521, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43521, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000153094, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms heterodimers with a number of antiapoptotic Bcl-2 proteins, including MCL1, BCL2, BCL2L1 isoform Bcl-X(L), BCL2A1/BFL-1, BHRF1, and BCL2L2/BCLW (PubMed:11997495, PubMed:27013495, PubMed:18812174). Isoform BimS and isoform Bim-alpha3 interact with BAX; this interaction may lead to BAX activation through conformational change (PubMed:11997495). Does not heterodimerize with proapoptotic proteins such as BAD, BOK or BAK.

Identified in a complex containing BCL2L11, DYNLL1 and BCL2L1 isoform Bcl-X(L); BH3 integrity is required for BCL2L1-binding.

Interacts with YWHAZ. When phosphorylated, interacts with TRIM2; this interaction is associated with ubiquitination and degradation (PubMed:21478148).

Interacts with MCL1; may sequester BCL2L11 to prevent its pro-apoptotic activity (PubMed:27013495, PubMed:17389404). When phosphorylated, isoform BimEL interacts with USP27X; this interaction leads to BCL2L11 deubiquitination and stabilization (PubMed:27013495).

Interacts with GIMAP5 (PubMed:16509771).

6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115335, 67 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-1985, BIM:BCL-XL complex
CPX-1990, BIM:BCL-2 complex
CPX-481, MCL-1-BIM complex

Database of interacting proteins

More...DIPi		DIP-29185N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		O43521

Protein interaction database and analysis system

More...IntActi		O43521, 56 interactors

Molecular INTeraction database

More...MINTi		O43521

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000376943

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O43521

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43521, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43521

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O43521

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi148 – 162BH3Add BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The BH3 motif is required for interaction with Bcl-2 proteins and cytotoxicity.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S0DF, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003178

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_171932_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43521

Identification of Orthologs from Complete Genome Data

More...OMAi		ADMRPEM

Database of Orthologous Groups

More...OrthoDBi		1460067at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43521

TreeFam database of animal gene trees

More...TreeFami		TF335898

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR014771, Apoptosis_Bim_N
IPR017288, Bcl-2-like_11
IPR015040, Bcl-x_interacting_BH3_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08945, Bclx_interact, 1 hit
PF06773, Bim_N, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037827, Bcl-2-like_p11, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (20+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 20 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 20 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform BimEL (identifier: O43521-1) [UniParc]FASTAAdd to basket
Also known as: Bim(EL)

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKQPSDVSS ECDREGRQLQ PAERPPQLRP GAPTSLQTEP QGNPEGNHGG 
        60         70         80         90        100
EGDSCPHGSP QGPLAPPASP GPFATRSPLF IFMRRSSLLS RSSSGYFSFD 
       110        120        130        140        150
TDRSPAPMSC DKSTQTPSPP CQAFNHYLSA MASMRQAEPA DMRPEIWIAQ 
       160        170        180        190 
ELRRIGDEFN AYYARRVFLN NYQAAEDHPR MVILRLLRYI VRLVWRMH
Length:198
Mass (Da):22,171
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD75735E469CA6997
GO
Isoform BimL (identifier: O43521-2) [UniParc]FASTAAdd to basket
Also known as: Bim(L)

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.

Show »
Length:138
Mass (Da):15,967
Checksum:i8BB4AAE06CB080FA
GO
Isoform BimS (identifier: O43521-3) [UniParc]FASTAAdd to basket
Also known as: BCL2-like 11 transcript variant 9, Bim(S)

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.

Show »
Length:108
Mass (Da):12,717
Checksum:i60067208524D5BEA
GO
Isoform Bim-alpha1 (identifier: O43521-4) [UniParc]FASTAAdd to basket
Also known as: BimABCD, Bim-ABCD

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:169
Mass (Da):18,536
Checksum:iE2E24D5697C955BA
GO
Isoform Bim-alpha2 (identifier: O43521-5) [UniParc]FASTAAdd to basket
Also known as: BimACD, Bim-ACD

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:109
Mass (Da):12,332
Checksum:i4335FA21C13B49AD
GO
Isoform Bim-alpha3 (identifier: O43521-6) [UniParc]FASTAAdd to basket
Also known as: BCL2-like 11 transcript variant 10, BimAD, Bim-AD

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LEK

Show »
Length:79
Mass (Da):9,081
Checksum:i3E03CCF2154A242C
GO
Isoform Bim-alpha4 (identifier: O43521-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → LAKLLASST

Show »
Length:85
Mass (Da):9,596
Checksum:i7A6FD9AF07DA3E05
GO
Isoform Bim-alpha5 (identifier: O43521-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:172
Mass (Da):18,816
Checksum:iD2F7FC06EE3CE697
GO
Isoform Bim-alpha6 (identifier: O43521-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-131: Missing.
     167-198: VFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH → MPLPPD

Show »
Length:82
Mass (Da):9,362
Checksum:i08678A7A0FBD4215
GO
Isoform Bim-beta1 (identifier: O43521-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-135: SMR → NWD
     136-198: Missing.

Show »
Length:135
Mass (Da):14,458
Checksum:iD208F1CB6D324539
GO
Isoform Bim-beta2 (identifier: O43521-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:135
Mass (Da):14,418
Checksum:iD3A245DECD324539
GO
Isoform Bim-beta3 (identifier: O43521-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-75: GNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFAT → VSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK

Show »
Length:198
Mass (Da):22,649
Checksum:iA8FA866EBD5CF16E
GO
Isoform Bim-beta4 (identifier: O43521-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-44: NP → IF
     45-198: Missing.

Show »
Length:44
Mass (Da):4,834
Checksum:iFA9541901CA32FD1
GO
Isoform Bim-beta5 (identifier: O43521-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:140
Mass (Da):15,025
Checksum:iB7590CC04A98E081
GO
Isoform Bim-beta6 (identifier: O43521-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-135: ASMR → GIFE
     136-198: Missing.

Show »
Length:75
Mass (Da):8,214
Checksum:i7CFE6B5A5ED671F3
GO
Isoform Bim-beta7 (identifier: O43521-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-140: ASMRQAEPA → VREIEEVVV
     141-198: Missing.

Show »
Length:80
Mass (Da):8,821
Checksum:i6958582B30D7BCAF
GO
Isoform Bim-gamma (identifier: O43521-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-198: ASMRQAEPAD...YIVRLVWRMH → VVILEDIGDL...TEQLNHKDFS

Show »
Length:112
Mass (Da):12,412
Checksum:i15E21254C12C239B
GO
Isoform BimABC (identifier: O43521-18) [UniParc]FASTAAdd to basket
Also known as: Bim-ABC

The sequence of this isoform differs from the canonical sequence as follows:
     42-101: Missing.
     132-166: Missing.

Show »
Length:103
Mass (Da):11,773
Checksum:iFD4F4A9292591961
GO
Isoform BimAC (identifier: O43521-19) [UniParc]FASTAAdd to basket
Also known as: Bim-AC

The sequence of this isoform differs from the canonical sequence as follows:
     132-166: Missing.

Show »
Length:163
Mass (Da):17,977
Checksum:i215890B3975C25A5
GO
Isoform BimA (identifier: O43521-20) [UniParc]FASTAAdd to basket
Also known as: Bim-A

The sequence of this isoform differs from the canonical sequence as follows:
     42-166: Missing.

Show »
Length:73
Mass (Da):8,523
Checksum:iD0CE170469B8570D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRE7A0A0A0MRE7_HUMAN
Bcl-2-like protein 11
BCL2L11
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J417C9J417_HUMAN
Bcl-2-like protein 11
BCL2L11
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZE5H7BZE5_HUMAN
Bcl-2-like protein 11
BCL2L11
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DH20A0A0C4DH20_HUMAN
Bcl-2-like protein 11
BCL2L11
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PAM9E9PAM9_HUMAN
Bcl-2-like protein 11
BCL2L11
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti33P → L in BAF83066 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04286542 – 166Missing in isoform BimA. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_03560842 – 131Missing in isoform BimS, isoform Bim-alpha3, isoform Bim-alpha6 and isoform Bim-alpha4. 3 PublicationsAdd BLAST90
Alternative sequenceiVSP_00053542 – 101Missing in isoform BimABC, isoform BimL, isoform Bim-alpha2, isoform Bim-gamma, isoform Bim-beta6 and isoform Bim-beta7. 6 PublicationsAdd BLAST60
Alternative sequenceiVSP_03560942 – 75GNPEG…GPFAT → VSLCHPGWSALVRSWLTATS NSQVQAVLLPQPPK in isoform Bim-beta3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03561043 – 44NP → IF in isoform Bim-beta4. 1 Publication2
Alternative sequenceiVSP_03561145 – 198Missing in isoform Bim-beta4. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_035612132 – 198ASMRQ…VWRMH → VVILEDIGDLSLCFGFIFTG LDLYGHHHSQDTEQLNHKDF S in isoform Bim-gamma. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_042866132 – 166Missing in isoform BimAC and isoform BimABC. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_035613132 – 140ASMRQAEPA → VREIEEVVV in isoform Bim-beta5 and isoform Bim-beta7. 1 Publication9
Alternative sequenceiVSP_035614132 – 135ASMR → GIFE in isoform Bim-beta2 and isoform Bim-beta6. 2 Publications4
Alternative sequenceiVSP_035615133 – 135SMR → NWD in isoform Bim-beta1. 1 Publication3
Alternative sequenceiVSP_035616136 – 198Missing in isoform Bim-beta1, isoform Bim-beta2 and isoform Bim-beta6. 2 PublicationsAdd BLAST63
Alternative sequenceiVSP_035617141 – 198Missing in isoform Bim-beta5 and isoform Bim-beta7. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_035620167 – 198VFLNN…VWRMH → LEK in isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3. 4 PublicationsAdd BLAST32
Alternative sequenceiVSP_035618167 – 198VFLNN…VWRMH → LAKLLASST in isoform Bim-alpha4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_035619167 – 198VFLNN…VWRMH → MPLPPD in isoform Bim-alpha5 and isoform Bim-alpha6. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF032457 mRNA Translation: AAC39593.1
AF032458 mRNA Translation: AAC39594.1
AB071195 mRNA Translation: BAB78589.1
AB071196 mRNA Translation: BAB78590.1
AB071197 mRNA Translation: BAB78591.1
AB071198 mRNA Translation: BAB78592.1
AB071199 mRNA Translation: BAB78593.1
AB071200 mRNA Translation: BAB78594.1
AY352518 mRNA Translation: AAQ62569.1
AY305714 mRNA Translation: AAQ82546.1
AY305715 mRNA Translation: AAQ82547.1
AY423441 mRNA Translation: AAQ99148.1
AY423442 mRNA Translation: AAQ99149.1
AY423443 mRNA Translation: AAQ99150.1
AY428962 mRNA Translation: AAR06908.1
DQ849200 mRNA Translation: ABI13589.1
DQ849201 mRNA Translation: ABI13590.1
DQ849202 mRNA Translation: ABI13591.1
AK290377 mRNA Translation: BAF83066.1
AK291269 mRNA Translation: BAF83958.1
AC096670 Genomic DNA Translation: AAY14797.1
CH471237 Genomic DNA Translation: EAW50365.1
CH471237 Genomic DNA Translation: EAW50367.1
CH471237 Genomic DNA Translation: EAW50369.1
CH471237 Genomic DNA Translation: EAW50370.1
CH471237 Genomic DNA Translation: EAW50371.1
CH471237 Genomic DNA Translation: EAW50372.1
CH471237 Genomic DNA Translation: EAW50373.1
CH471237 Genomic DNA Translation: EAW50374.1
BC033694 mRNA Translation: AAH33694.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2089.1 [O43521-1]
CCDS2092.1 [O43521-17]
CCDS42731.1 [O43521-2]
CCDS56131.1 [O43521-16]
CCDS56132.1 [O43521-7]
CCDS56133.1 [O43521-9]
CCDS56134.1 [O43521-10]
CCDS56135.1 [O43521-8]
CCDS56136.1 [O43521-14]
CCDS74560.1 [O43521-4]
CCDS74561.1 [O43521-11]

NCBI Reference Sequences

More...RefSeqi		NP_001191035.1, NM_001204106.1 [O43521-3]
NP_001191036.1, NM_001204107.1 [O43521-7]
NP_001191037.1, NM_001204108.1 [O43521-8]
NP_001191038.1, NM_001204109.1 [O43521-14]
NP_001191039.1, NM_001204110.1 [O43521-9]
NP_001191040.1, NM_001204111.1 [O43521-15]
NP_001191041.1, NM_001204112.1 [O43521-16]
NP_001191042.1, NM_001204113.1
NP_006529.1, NM_006538.4 [O43521-2]
NP_619527.1, NM_138621.4 [O43521-1]
NP_619528.1, NM_138622.3 [O43521-4]
NP_619529.1, NM_138623.3 [O43521-5]
NP_619530.1, NM_138624.3 [O43521-10]
NP_619531.1, NM_138625.3
NP_619532.1, NM_138626.3 [O43521-11]
NP_619533.1, NM_138627.3
NP_996885.1, NM_207002.3 [O43521-17]
NP_996886.1, NM_207003.2 [O43521-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000308659; ENSP00000309226; ENSG00000153094 [O43521-2]
ENST00000337565; ENSP00000338374; ENSG00000153094 [O43521-17]
ENST00000393256; ENSP00000376943; ENSG00000153094 [O43521-1]
ENST00000405953; ENSP00000384641; ENSG00000153094 [O43521-17]
ENST00000415458; ENSP00000393781; ENSG00000153094 [O43521-16]
ENST00000431217; ENSP00000394640; ENSG00000153094 [O43521-10]
ENST00000433098; ENSP00000401662; ENSG00000153094 [O43521-5]
ENST00000436733; ENSP00000403727; ENSG00000153094 [O43521-14]
ENST00000437029; ENSP00000412892; ENSG00000153094 [O43521-8]
ENST00000439718; ENSP00000411137; ENSG00000153094 [O43521-7]
ENST00000452231; ENSP00000391292; ENSG00000153094 [O43521-9]
ENST00000610735; ENSP00000481030; ENSG00000153094 [O43521-14]
ENST00000615946; ENSP00000481423; ENSG00000153094 [O43521-7]
ENST00000619294; ENSP00000479714; ENSG00000153094 [O43521-10]
ENST00000620862; ENSP00000478133; ENSG00000153094 [O43521-5]
ENST00000621302; ENSP00000481652; ENSG00000153094 [O43521-4]
ENST00000622509; ENSP00000482175; ENSG00000153094 [O43521-8]
ENST00000622612; ENSP00000484360; ENSG00000153094 [O43521-11]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10018

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10018

UCSC genome browser

More...UCSCi		uc002tgt.2, human [O43521-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF032457 mRNA Translation: AAC39593.1
AF032458 mRNA Translation: AAC39594.1
AB071195 mRNA Translation: BAB78589.1
AB071196 mRNA Translation: BAB78590.1
AB071197 mRNA Translation: BAB78591.1
AB071198 mRNA Translation: BAB78592.1
AB071199 mRNA Translation: BAB78593.1
AB071200 mRNA Translation: BAB78594.1
AY352518 mRNA Translation: AAQ62569.1
AY305714 mRNA Translation: AAQ82546.1
AY305715 mRNA Translation: AAQ82547.1
AY423441 mRNA Translation: AAQ99148.1
AY423442 mRNA Translation: AAQ99149.1
AY423443 mRNA Translation: AAQ99150.1
AY428962 mRNA Translation: AAR06908.1
DQ849200 mRNA Translation: ABI13589.1
DQ849201 mRNA Translation: ABI13590.1
DQ849202 mRNA Translation: ABI13591.1
AK290377 mRNA Translation: BAF83066.1
AK291269 mRNA Translation: BAF83958.1
AC096670 Genomic DNA Translation: AAY14797.1
CH471237 Genomic DNA Translation: EAW50365.1
CH471237 Genomic DNA Translation: EAW50367.1
CH471237 Genomic DNA Translation: EAW50369.1
CH471237 Genomic DNA Translation: EAW50370.1
CH471237 Genomic DNA Translation: EAW50371.1
CH471237 Genomic DNA Translation: EAW50372.1
CH471237 Genomic DNA Translation: EAW50373.1
CH471237 Genomic DNA Translation: EAW50374.1
BC033694 mRNA Translation: AAH33694.1
CCDSiCCDS2089.1 [O43521-1]
CCDS2092.1 [O43521-17]
CCDS42731.1 [O43521-2]
CCDS56131.1 [O43521-16]
CCDS56132.1 [O43521-7]
CCDS56133.1 [O43521-9]
CCDS56134.1 [O43521-10]
CCDS56135.1 [O43521-8]
CCDS56136.1 [O43521-14]
CCDS74560.1 [O43521-4]
CCDS74561.1 [O43521-11]
RefSeqiNP_001191035.1, NM_001204106.1 [O43521-3]
NP_001191036.1, NM_001204107.1 [O43521-7]
NP_001191037.1, NM_001204108.1 [O43521-8]
NP_001191038.1, NM_001204109.1 [O43521-14]
NP_001191039.1, NM_001204110.1 [O43521-9]
NP_001191040.1, NM_001204111.1 [O43521-15]
NP_001191041.1, NM_001204112.1 [O43521-16]
NP_001191042.1, NM_001204113.1
NP_006529.1, NM_006538.4 [O43521-2]
NP_619527.1, NM_138621.4 [O43521-1]
NP_619528.1, NM_138622.3 [O43521-4]
NP_619529.1, NM_138623.3 [O43521-5]
NP_619530.1, NM_138624.3 [O43521-10]
NP_619531.1, NM_138625.3
NP_619532.1, NM_138626.3 [O43521-11]
NP_619533.1, NM_138627.3
NP_996885.1, NM_207002.3 [O43521-17]
NP_996886.1, NM_207003.2 [O43521-6]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F95NMR-C/D108-116[»]
2K7WNMR-B145-164[»]
2NL9X-ray1.55B141-166[»]
2V6QX-ray2.70B141-166[»]
2VM6X-ray2.20B141-165[»]
2WH6X-ray1.50B141-166[»]
2YQ6X-ray1.80B147-164[»]
2YQ7X-ray1.90B147-164[»]
3D7VX-ray2.03B141-166[»]
3FDLX-ray1.78B141-166[»]
3IO8X-ray2.30B/D141-166[»]
3IO9X-ray2.40B141-166[»]
3KJ0X-ray1.70B143-165[»]
3KJ1X-ray1.94B143-163[»]
3KJ2X-ray2.35B143-163[»]
4A1UX-ray1.54B146-163[»]
4A1WX-ray2.50P/Q/R/S146-163[»]
4B4SX-ray1.90B141-166[»]
4D2MX-ray2.10B/D141-166[»]
4QVFX-ray1.53B141-166[»]
4UF3X-ray2.70B141-166[»]
4YJ4X-ray2.10B146-165[»]
4ZIEX-ray1.80C141-166[»]
4ZIFX-ray2.40B141-160[»]
4ZIHX-ray2.50B141-160[»]
5AGWX-ray2.69C/D146-166[»]
5AGXX-ray2.24C/D146-166[»]
5C3GX-ray2.45B146-166[»]
5VWVX-ray1.90B141-165[»]
5VWWX-ray2.80C/D141-166[»]
5VWXX-ray2.49B/D142-164[»]
5VWYX-ray1.55B141-166[»]
5VWZX-ray1.62B/D141-166[»]
5VX0X-ray1.60B/D141-166[»]
5VX2X-ray1.85B/D141-166[»]
5VX3X-ray1.95B/D/F/H141-166[»]
5WOSX-ray2.45B141-166[»]
6QFIX-ray2.40B141-166[»]
6RJPX-ray2.57C/D147-163[»]
6TQQX-ray3.00B141-166[»]
6UA3X-ray1.55B146-166[»]
6UABX-ray2.10B146-166[»]
6X8OX-ray1.31A/B/C/D141-166[»]
SMRiO43521
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115335, 67 interactors
ComplexPortaliCPX-1985, BIM:BCL-XL complex
CPX-1990, BIM:BCL-2 complex
CPX-481, MCL-1-BIM complex
DIPiDIP-29185N
ELMiO43521
IntActiO43521, 56 interactors
MINTiO43521
STRINGi9606.ENSP00000376943

Chemistry databases

BindingDBiO43521
ChEMBLiCHEMBL5777

Protein family/group databases

TCDBi8.A.69.1.1, the pro-apoptotic bcl-2-family protein bim (bim) family

PTM databases

iPTMnetiO43521
PhosphoSitePlusiO43521

Genetic variation databases

BioMutaiBCL2L11

Proteomic databases

MassIVEiO43521
MaxQBiO43521
PaxDbiO43521
PeptideAtlasiO43521
PRIDEiO43521
ProteomicsDBi49009 [O43521-1]
49010 [O43521-10]
49011 [O43521-11]
49012 [O43521-12]
49013 [O43521-13]
49014 [O43521-14]
49015 [O43521-15]
49016 [O43521-16]
49017 [O43521-17]
49018 [O43521-18]
49019 [O43521-19]
49020 [O43521-2]
49021 [O43521-20]
49022 [O43521-3]
49023 [O43521-4]
49024 [O43521-5]
49025 [O43521-6]
49026 [O43521-7]
49027 [O43521-8]
49028 [O43521-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3621, 1264 antibodies

The DNASU plasmid repository

More...DNASUi		10018

Genome annotation databases

EnsembliENST00000308659; ENSP00000309226; ENSG00000153094 [O43521-2]
ENST00000337565; ENSP00000338374; ENSG00000153094 [O43521-17]
ENST00000393256; ENSP00000376943; ENSG00000153094 [O43521-1]
ENST00000405953; ENSP00000384641; ENSG00000153094 [O43521-17]
ENST00000415458; ENSP00000393781; ENSG00000153094 [O43521-16]
ENST00000431217; ENSP00000394640; ENSG00000153094 [O43521-10]
ENST00000433098; ENSP00000401662; ENSG00000153094 [O43521-5]
ENST00000436733; ENSP00000403727; ENSG00000153094 [O43521-14]
ENST00000437029; ENSP00000412892; ENSG00000153094 [O43521-8]
ENST00000439718; ENSP00000411137; ENSG00000153094 [O43521-7]
ENST00000452231; ENSP00000391292; ENSG00000153094 [O43521-9]
ENST00000610735; ENSP00000481030; ENSG00000153094 [O43521-14]
ENST00000615946; ENSP00000481423; ENSG00000153094 [O43521-7]
ENST00000619294; ENSP00000479714; ENSG00000153094 [O43521-10]
ENST00000620862; ENSP00000478133; ENSG00000153094 [O43521-5]
ENST00000621302; ENSP00000481652; ENSG00000153094 [O43521-4]
ENST00000622509; ENSP00000482175; ENSG00000153094 [O43521-8]
ENST00000622612; ENSP00000484360; ENSG00000153094 [O43521-11]
GeneIDi10018
KEGGihsa:10018
UCSCiuc002tgt.2, human [O43521-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10018
DisGeNETi10018

GeneCards: human genes, protein and diseases

More...GeneCardsi		BCL2L11
HGNCiHGNC:994, BCL2L11
HPAiENSG00000153094, Low tissue specificity
MIMi603827, gene
neXtProtiNX_O43521
OpenTargetsiENSG00000153094
PharmGKBiPA25305
VEuPathDBiHostDB:ENSG00000153094.21

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S0DF, Eukaryota
GeneTreeiENSGT00390000003178
HOGENOMiCLU_171932_0_0_1
InParanoidiO43521
OMAiADMRPEM
OrthoDBi1460067at2759
PhylomeDBiO43521
TreeFamiTF335898

Enzyme and pathway databases

PathwayCommonsiO43521
ReactomeiR-HSA-111446, Activation of BIM and translocation to mitochondria
R-HSA-111453, BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-193648, NRAGE signals death through JNK
R-HSA-6802952, Signaling by BRAF and RAF fusions
R-HSA-8862803, Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
R-HSA-8952158, RUNX3 regulates BCL2L11 (BIM) transcription
R-HSA-9607240, FLT3 Signaling
R-HSA-9614657, FOXO-mediated transcription of cell death genes
SIGNORiO43521

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10018, 14 hits in 1000 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BCL2L11, human
EvolutionaryTraceiO43521

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BCL2L11

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10018
PharosiO43521, Tbio

Protein Ontology

More...PROi		PR:O43521
RNActiO43521, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000153094, Expressed in sperm and 203 other tissues
ExpressionAtlasiO43521, baseline and differential
GenevisibleiO43521, HS

Family and domain databases

InterProiView protein in InterPro
IPR014771, Apoptosis_Bim_N
IPR017288, Bcl-2-like_11
IPR015040, Bcl-x_interacting_BH3_dom
PfamiView protein in Pfam
PF08945, Bclx_interact, 1 hit
PF06773, Bim_N, 1 hit
PIRSFiPIRSF037827, Bcl-2-like_p11, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiB2L11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43521
Secondary accession number(s): A8K2W2
, O43522, Q0MSE7, Q0MSE8, Q0MSE9, Q53R28, Q6JTU6, Q6T851, Q6TE14, Q6TE15, Q6TE16, Q6V402, Q8WYL6, Q8WYL7, Q8WYL8, Q8WYL9, Q8WYM0, Q8WYM1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: June 1, 1998
Last modified: April 7, 2021
This is version 197 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again