Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43493 (TGON2_HUMAN)

Entry version 175 (10 Feb 2021)
Sequence version 4 (18 Sep 2019)
Previous versions | rss
Add a publicationFeedback
Protein

Trans-Golgi network integral membrane protein 2

Gene

TGOLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in regulating membrane traffic to and from trans-Golgi network.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43493

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-381426, Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-432722, Golgi Associated Vesicle Biogenesis
R-HSA-6811440, Retrograde transport at the Trans-Golgi-Network
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
R-HSA-8957275, Post-translational protein phosphorylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Trans-Golgi network integral membrane protein 2Curated
Alternative name(s):
Trans-Golgi network glycoprotein 461 Publication
Short name:
TGN38 homolog1 Publication
Short name:
hTGN461 Publication
Trans-Golgi network glycoprotein 481 Publication
Short name:
hTGN481 Publication
Trans-Golgi network glycoprotein 511 Publication
Short name:
hTGN511 Publication
Trans-Golgi network protein 2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TGOLN2Imported
Synonyms:TGN46, TGN51
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:15450, TGOLN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603062, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43493

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000152291.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini22 – 381ExtracellularSequence analysisAdd BLAST360
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei382 – 402HelicalSequence analysisAdd BLAST21
Topological domaini403 – 437CytoplasmicSequence analysisAdd BLAST35

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi430Y → A: Loss of relocalization to the trans-Golgi. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		10618

Open Targets

More...OpenTargetsi		ENSG00000152291

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37959

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43493, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TGOLN2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002248622 – 437Trans-Golgi network integral membrane protein 2Add BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi39N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei71Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi82N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi152N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi180N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi208N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei221Phosphoserine; by FAM20C1 Publication1
Glycosylationi222N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei298Phosphoserine; by FAM20CCombined sources1 Publication1
Modified residuei302Phosphothreonine; by FAM20C1 Publication1
Modified residuei351Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi373N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi377N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43493

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43493

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43493

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43493

PeptideAtlas

More...PeptideAtlasi		O43493

PRoteomics IDEntifications database

More...PRIDEi		O43493

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		30219
30837
48977 [O43493-2]
48978 [O43493-3]
48979 [O43493-4]
48980 [O43493-5]
48981 [O43493-6]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O43493, 13 sites, 1 O-linked glycan (4 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43493

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43493

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000152291, Expressed in adult mammalian kidney and 256 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43493, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000152291, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		115864, 465 interactors

Protein interaction database and analysis system

More...IntActi		O43493, 455 interactors

Molecular INTeraction database

More...MINTi		O43493

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000386443

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43493, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati54 – 671Add BLAST14
Repeati68 – 812Add BLAST14
Repeati82 – 953Add BLAST14
Repeati96 – 1094Add BLAST14
Repeati110 – 1235Add BLAST14
Repeati124 – 1376Add BLAST14
Repeati138 – 1517Add BLAST14
Repeati152 – 1658Add BLAST14
Repeati166 – 1799Add BLAST14
Repeati180 – 19310Add BLAST14
Repeati194 – 20711Add BLAST14
Repeati208 – 22112Add BLAST14
Repeati222 – 23413Add BLAST13
Repeati235 – 24914Add BLAST15

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni54 – 24914 X 14 AA tandem repeatsAdd BLAST196

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi395 – 398Endocytosis signal; in isoform TGN514
Motifi418 – 421Endocytosis signal; in isoform TGN514
Motifi430 – 433Endocytosis signal; in isoform TGN46 and isoform TGN484

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S6YU, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00530000064712

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_047350_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43493

Database of Orthologous Groups

More...OrthoDBi		1481309at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43493

TreeFam database of animal gene trees

More...TreeFami		TF332514

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform TGN46 (identifier: O43493-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP 
        60         70         80         90        100
GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA 
       110        120        130        140        150
EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS 
       160        170        180        190        200
PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED 
       210        220        230        240        250
QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN 
       260        270        280        290        300
KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE 
       310        320        330        340        350
ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA 
       360        370        380        390        400
SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY 
       410        420        430 
IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKS
Length:437
Mass (Da):45,880
Last modified:September 18, 2019 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6F72467FED83A1A3
GO
Isoform TGN48 (identifier: O43493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-437: S → IFSPPSPNRMVYSSGKR

Show »
Length:453
Mass (Da):47,698
Checksum:iE3D3878CA946D0A3
GO
Isoform 4 (identifier: O43493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     251-309: KVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQ → K

Show »
Length:379
Mass (Da):39,563
Checksum:iD8BA8D5EB4EE7562
GO
Isoform 5 (identifier: O43493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-437: S → VRKEEPGPWEG

Show »
Length:447
Mass (Da):47,058
Checksum:i557721E4618F7331
GO
Isoform 6 (identifier: O43493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-168: Missing.
     252-309: Missing.

Show »
Length:281
Mass (Da):29,541
Checksum:i537C9B3CFADF7222
GO
Isoform 7 (identifier: O43493-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-437: S → YVLILNVFPAPPKRSFFP

Show »
Length:454
Mass (Da):47,880
Checksum:i8B6A2E45C93DB9C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5H1ZRP2A0A5H1ZRP2_HUMAN
Trans-Golgi network integral membra...
TGOLN2
479Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9UY30A0A5F9UY30_HUMAN
Trans-Golgi network integral membra...
TGOLN2
453Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti30E → D in AAH08461 (PubMed:15489334).Curated1
Sequence conflicti71S → G in BAD96549 (Ref. 4) Curated1
Sequence conflicti74A → P in BAD96783 (Ref. 4) Curated1
Sequence conflicti158A → P in AAB96906 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96907 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96908 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39539 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39541 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39542 (PubMed:9422759).Curated1
Sequence conflicti386F → S in CAE45926 (PubMed:17974005).Curated1
Isoform TGN48 (identifier: O43493-3)
Sequence conflicti439S → F in AAC39541 (PubMed:9422759).1
Sequence conflicti439S → F in AAB96907 (PubMed:9422759).1
Isoform 7 (identifier: O43493-7)
Sequence conflicti453F → L in AAB96908 (PubMed:9422759).1
Sequence conflicti453F → L in AAC39542 (PubMed:9422759).1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03472410L → V1 PublicationCorresponds to variant dbSNP:rs1128140Ensembl.1
Natural variantiVAR_03472586A → G1 PublicationCorresponds to variant dbSNP:rs1044962Ensembl.1
Natural variantiVAR_03472691Q → L1 PublicationCorresponds to variant dbSNP:rs1044963Ensembl.1
Natural variantiVAR_034727103K → Q1 PublicationCorresponds to variant dbSNP:rs1044964Ensembl.1
Natural variantiVAR_034728105Q → P1 Publication1
Natural variantiVAR_034729259R → W4 PublicationsCorresponds to variant dbSNP:rs4247303Ensembl.1
Natural variantiVAR_034730322E → G1 PublicationCorresponds to variant dbSNP:rs1044969Ensembl.1
Isoform TGN48 (identifier: O43493-3)
Natural variantiVAR_082887441P → LCuratedCorresponds to variant dbSNP:rs4240199Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_06031871 – 168Missing in isoform 6. Add BLAST98
Alternative sequenceiVSP_060319251 – 309KVVPE…ISPPQ → K in isoform 4. Add BLAST59
Alternative sequenceiVSP_060320252 – 309Missing in isoform 6. Add BLAST58
Alternative sequenceiVSP_060321437S → VRKEEPGPWEG in isoform 5. 1
Alternative sequenceiVSP_060322437S → YVLILNVFPAPPKRSFFP in isoform 7. 1
Alternative sequenceiVSP_060323437S → IFSPPSPNRMVYSSGKR in isoform TGN48. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF029316 AF029315 Genomic DNA Translation: AAB96906.1
AF029316 AF029315 Genomic DNA Translation: AAB96907.1
AF029316 AF029315 Genomic DNA Translation: AAB96908.1
U62390 mRNA Translation: AAC39539.1
AF027515 mRNA Translation: AAC39541.1
AF027516 mRNA Translation: AAC39542.1
X94333 mRNA Translation: CAA64002.1
AK126465 mRNA Translation: BAC86559.1
AK222829 mRNA Translation: BAD96549.1
AK223063 mRNA Translation: BAD96783.1
AK312479 mRNA Translation: BAG35383.1
BX640868 mRNA Translation: CAE45926.1
AC093162 Genomic DNA Translation: AAY24095.1
CH471053 Genomic DNA Translation: EAW99535.1
CH471053 Genomic DNA Translation: EAW99536.1
CH471053 Genomic DNA Translation: EAW99539.1
BC008461 mRNA Translation: AAH08461.1
BC028219 mRNA Translation: AAH28219.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46351.1 [O43493-2]
CCDS56126.1 [O43493-3]
CCDS56127.1 [O43493-4]

NCBI Reference Sequences

More...RefSeqi		NP_001193769.1, NM_001206840.1
NP_001193770.1, NM_001206841.1
NP_001193773.1, NM_001206844.1 [O43493-4]
NP_006455.2, NM_006464.3 [O43493-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000377386; ENSP00000366603; ENSG00000152291 [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291 [O43493-4]
ENST00000409015; ENSP00000387035; ENSG00000152291 [O43493-7]
ENST00000444342; ENSP00000391190; ENSG00000152291 [O43493-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10618

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10618

UCSC genome browser

More...UCSCi		uc002soz.4, human [O43493-2]
uc021vjw.2, human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316 AF029315 Genomic DNA Translation: AAB96906.1
AF029316 AF029315 Genomic DNA Translation: AAB96907.1
AF029316 AF029315 Genomic DNA Translation: AAB96908.1
U62390 mRNA Translation: AAC39539.1
AF027515 mRNA Translation: AAC39541.1
AF027516 mRNA Translation: AAC39542.1
X94333 mRNA Translation: CAA64002.1
AK126465 mRNA Translation: BAC86559.1
AK222829 mRNA Translation: BAD96549.1
AK223063 mRNA Translation: BAD96783.1
AK312479 mRNA Translation: BAG35383.1
BX640868 mRNA Translation: CAE45926.1
AC093162 Genomic DNA Translation: AAY24095.1
CH471053 Genomic DNA Translation: EAW99535.1
CH471053 Genomic DNA Translation: EAW99536.1
CH471053 Genomic DNA Translation: EAW99539.1
BC008461 mRNA Translation: AAH08461.1
BC028219 mRNA Translation: AAH28219.1
CCDSiCCDS46351.1 [O43493-2]
CCDS56126.1 [O43493-3]
CCDS56127.1 [O43493-4]
RefSeqiNP_001193769.1, NM_001206840.1
NP_001193770.1, NM_001206841.1
NP_001193773.1, NM_001206844.1 [O43493-4]
NP_006455.2, NM_006464.3 [O43493-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6YAFelectron microscopy9.10P420-434[»]
ModBaseiSearch...
SWISS-MODEL-WorkspaceiSubmit a new modelling project...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi115864, 465 interactors
IntActiO43493, 455 interactors
MINTiO43493
STRINGi9606.ENSP00000386443

PTM databases

GlyGeniO43493, 13 sites, 1 O-linked glycan (4 sites)
iPTMnetiO43493
PhosphoSitePlusiO43493

Genetic variation databases

BioMutaiTGOLN2

Proteomic databases

EPDiO43493
jPOSTiO43493
MassIVEiO43493
PaxDbiO43493
PeptideAtlasiO43493
PRIDEiO43493
ProteomicsDBi30219
30837
48977 [O43493-2]
48978 [O43493-3]
48979 [O43493-4]
48980 [O43493-5]
48981 [O43493-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2516, 316 antibodies

The DNASU plasmid repository

More...DNASUi		10618

Genome annotation databases

EnsembliENST00000377386; ENSP00000366603; ENSG00000152291 [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291 [O43493-4]
ENST00000409015; ENSP00000387035; ENSG00000152291 [O43493-7]
ENST00000444342; ENSP00000391190; ENSG00000152291 [O43493-5]
GeneIDi10618
KEGGihsa:10618
UCSCiuc002soz.4, human [O43493-2]
uc021vjw.2, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10618
DisGeNETi10618

GeneCards: human genes, protein and diseases

More...GeneCardsi		TGOLN2
HGNCiHGNC:15450, TGOLN2
HPAiENSG00000152291, Low tissue specificity
MIMi603062, gene
neXtProtiNX_O43493
OpenTargetsiENSG00000152291
PharmGKBiPA37959
VEuPathDBiHostDB:ENSG00000152291.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S6YU, Eukaryota
GeneTreeiENSGT00530000064712
HOGENOMiCLU_047350_0_0_1
InParanoidiO43493
OrthoDBi1481309at2759
PhylomeDBiO43493
TreeFamiTF332514

Enzyme and pathway databases

PathwayCommonsiO43493
ReactomeiR-HSA-381426, Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-432722, Golgi Associated Vesicle Biogenesis
R-HSA-6811440, Retrograde transport at the Trans-Golgi-Network
R-HSA-8856825, Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828, Clathrin-mediated endocytosis
R-HSA-8957275, Post-translational protein phosphorylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10618, 4 hits in 880 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TGOLN2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TGOLN2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10618
PharosiO43493, Tbio

Protein Ontology

More...PROi		PR:O43493
RNActiO43493, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000152291, Expressed in adult mammalian kidney and 256 other tissues
GenevisibleiO43493, HS

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTGON2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43493
Secondary accession number(s): B2R686
, B8ZZ88, D6W5K3, F8W8W7, F8WBK2, J3KQ45, O15282, O43492, O43499, O43500, O43501, Q53G68, Q53GV2, Q6MZV1, Q6ZTM7, Q8N6T8, Q92760, Q96QL2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: September 18, 2019
Last modified: February 10, 2021
This is version 175 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again