Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trans-Golgi network integral membrane protein 2

Gene

TGOLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in regulating membrane traffic to and from trans-Golgi network.

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-432722 Golgi Associated Vesicle Biogenesis
R-HSA-6811440 Retrograde transport at the Trans-Golgi-Network
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8957275 Post-translational protein phosphorylation

Names & Taxonomyi

Protein namesi
Recommended name:
Trans-Golgi network integral membrane protein 2
Alternative name(s):
TGN38 homolog
TGN46
TGN48
Trans-Golgi network protein TGN51
Gene namesi
Name:TGOLN2
Synonyms:TGN46, TGN51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000152291.13
HGNCiHGNC:15450 TGOLN2
MIMi603062 gene
neXtProtiNX_O43493

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 381ExtracellularSequence analysisAdd BLAST360
Transmembranei382 – 402HelicalSequence analysisAdd BLAST21
Topological domaini403 – 479CytoplasmicSequence analysisAdd BLAST77

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi430Y → A: Loss of relocalization to the trans-Golgi. 1 Publication1

Organism-specific databases

DisGeNETi10618
OpenTargetsiENSG00000152291
PharmGKBiPA37959

Polymorphism and mutation databases

BioMutaiTGOLN2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000002248622 – 479Trans-Golgi network integral membrane protein 2Add BLAST458

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi39N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei71Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi82N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi152N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi180N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi208N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei221Phosphoserine; by FAM20C1 Publication1
Glycosylationi222N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei298Phosphoserine; by FAM20CCombined sources1 Publication1
Modified residuei302Phosphothreonine; by FAM20C1 Publication1
Modified residuei351Phosphoserine; by FAM20CCombined sources1 Publication1
Glycosylationi373N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi377N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiO43493
PaxDbiO43493
PeptideAtlasiO43493
PRIDEiO43493
ProteomicsDBi48976
48977 [O43493-2]
48978 [O43493-3]
48979 [O43493-4]
48980 [O43493-5]
48981 [O43493-6]

PTM databases

iPTMnetiO43493
PhosphoSitePlusiO43493

Expressioni

Tissue specificityi

Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.

Gene expression databases

BgeeiENSG00000152291 Expressed in 245 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiO43493 baseline and differential
GenevisibleiO43493 HS

Organism-specific databases

HPAiCAB011489
HPA012609
HPA012723

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi115864, 52 interactors
IntActiO43493, 424 interactors
MINTiO43493
STRINGi9606.ENSP00000386443

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati54 – 671Add BLAST14
Repeati68 – 812Add BLAST14
Repeati82 – 953Add BLAST14
Repeati96 – 1094Add BLAST14
Repeati110 – 1235Add BLAST14
Repeati124 – 1376Add BLAST14
Repeati138 – 1517Add BLAST14
Repeati152 – 1658Add BLAST14
Repeati166 – 1799Add BLAST14
Repeati180 – 19310Add BLAST14
Repeati194 – 20711Add BLAST14
Repeati208 – 22112Add BLAST14
Repeati222 – 23413Add BLAST13
Repeati235 – 24914Add BLAST15

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni54 – 24914 X 14 AA tandem repeatsAdd BLAST196

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi430 – 433Endocytosis signal; in isoform TGN46 and isoform TGN484
Motifi437 – 440Endocytosis signal; in isoform TGN514
Motifi460 – 463Endocytosis signal; in isoform TGN514

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IXPE Eukaryota
ENOG410XUUR LUCA
GeneTreeiENSGT00530000064712
HOGENOMiHOG000089969
HOVERGENiHBG108564
InParanoidiO43493
OMAiEEQGPID
OrthoDBiEOG091G02UO
PhylomeDBiO43493
TreeFamiTF332514

Family and domain databases

InterProiView protein in InterPro
IPR026084 TGN38
PANTHERiPTHR23211 PTHR23211, 1 hit

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform TGN51 (identifier: O43493-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFVVALVLL NVAAAGAVPL LATESVKQEE AGVRPSAGNV STHPSLSQRP
60 70 80 90 100
GGSTKSHPEP QTPKDSPSKS SAEAQTPEDT PNKSGAEAKT QKDSSNKSGA
110 120 130 140 150
EAKTQKGSTS KSGSEAQTTK DSTSKSHPEL QTPKDSTGKS GAEAQTPEDS
160 170 180 190 200
PNRSGAEAKT QKDSPSKSGS EAQTTKDVPN KSGADGQTPK DGSSKSGAED
210 220 230 240 250
QTPKDVPNKS GAEKQTPKDG SNKSGAEEQG PIDGPSKSGA EEQTSKDSPN
260 270 280 290 300
KVVPEQPSRK DHSKPISNPS DNKELPKADT NQLADKGKLS PHAFKTESGE
310 320 330 340 350
ETDLISPPQE EVKSSEPTED VEPKEAEDDD TGPEEGSPPK EEKEKMSGSA
360 370 380 390 400
SSENREGTLS DSTGSEKDDL YPNGSGNGSA ESSHFFAYLV TAAILVAVLY
410 420 430 440 450
IAHHNKRKII AFVLEGKRSK VTRRPKASDY QRLDQKYVLI LNVFPAPPKR
460 470
SFFPVLTEWY IPLEKDERHQ WIVLLSFQL
Length:479
Mass (Da):51,019
Last modified:March 28, 2018 - v3
Checksum:i65253DBCF3D7927B
GO
Isoform TGN46 (identifier: O43493-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-479: YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSFQL → S

Show »
Length:437
Mass (Da):45,880
Checksum:i6F72467FED83A1A3
GO
Isoform TGN48 (identifier: O43493-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-479: YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSFQL → IFFPLSPNRMVYSSGKR

Show »
Length:453
Mass (Da):47,774
Checksum:iE3D3878CB22AC0A2
GO
Isoform 4 (identifier: O43493-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     252-309: Missing.
     437-479: YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):39,563
Checksum:iD8BA8D5EB4EE7562
GO
Isoform 5 (identifier: O43493-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-479: YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSFQL → VRKEEPGPWEG

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):47,058
Checksum:i557721E4618F7331
GO
Isoform 6 (identifier: O43493-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-161: Missing.
     252-309: Missing.
     437-479: YVLILNVFPAPPKRSFFPVLTEWYIPLEKDERHQWIVLLSFQL → S

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):29,541
Checksum:i537C9B3CFADF7222
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti30E → D in AAH08461 (PubMed:15489334).Curated1
Sequence conflicti71S → G in BAD96549 (Ref. 4) Curated1
Sequence conflicti74A → P in BAD96783 (Ref. 4) Curated1
Sequence conflicti158A → P in AAB96906 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96907 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAB96908 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39539 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39541 (PubMed:9422759).Curated1
Sequence conflicti158A → P in AAC39542 (PubMed:9422759).Curated1
Sequence conflicti386F → S in CAE45926 (PubMed:17974005).Curated1
Sequence conflicti453 – 454FP → LPQ in AAB96908 (PubMed:9422759).2
Sequence conflicti454P → PQ in EAW99536 (Ref. 7) Curated1
Sequence conflicti454P → PQ in EAW99539 (Ref. 7) Curated1
Isoform TGN48 (identifier: O43493-3)
Sequence conflicti439F → S in AAC39541 (PubMed:9422759).Curated1
Sequence conflicti441L → P in AAC39541 (PubMed:9422759).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03472410L → V1 PublicationCorresponds to variant dbSNP:rs1128140Ensembl.1
Natural variantiVAR_03472586A → G1 PublicationCorresponds to variant dbSNP:rs1044962Ensembl.1
Natural variantiVAR_03472691Q → L1 PublicationCorresponds to variant dbSNP:rs1044963Ensembl.1
Natural variantiVAR_034727103K → Q1 PublicationCorresponds to variant dbSNP:rs1044964Ensembl.1
Natural variantiVAR_034728105Q → P1 Publication1
Natural variantiVAR_034729259R → W4 PublicationsCorresponds to variant dbSNP:rs4247303Ensembl.1
Natural variantiVAR_034730322E → G1 PublicationCorresponds to variant dbSNP:rs1044969Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02746964 – 161Missing in isoform 6. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_027470252 – 309Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_027471437 – 479YVLIL…LSFQL → VRKEEPGPWEG in isoform 5. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_004454437 – 479YVLIL…LSFQL → S in isoform TGN46, isoform 4 and isoform 6. 6 PublicationsAdd BLAST43
Alternative sequenceiVSP_004455437 – 479YVLIL…LSFQL → IFFPLSPNRMVYSSGKR in isoform TGN48. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96906.1
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96907.1
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96908.1
U62390 mRNA Translation: AAC39539.1
AF027515 mRNA Translation: AAC39541.1
AF027516 mRNA Translation: AAC39542.1
X94333 mRNA Translation: CAA64002.1
AK126465 mRNA Translation: BAC86559.1
AK222829 mRNA Translation: BAD96549.1
AK223063 mRNA Translation: BAD96783.1
AK312479 mRNA Translation: BAG35383.1
BX640868 mRNA Translation: CAE45926.1
AC093162 Genomic DNA Translation: AAY24095.1
CH471053 Genomic DNA Translation: EAW99535.1
CH471053 Genomic DNA Translation: EAW99536.1
CH471053 Genomic DNA Translation: EAW99539.1
BC008461 mRNA Translation: AAH08461.1
BC028219 mRNA Translation: AAH28219.1
CCDSiCCDS46351.1 [O43493-2]
CCDS56126.1 [O43493-3]
CCDS56127.1 [O43493-4]
RefSeqiNP_001193769.1, NM_001206840.1
NP_001193770.1, NM_001206841.1
NP_001193773.1, NM_001206844.1 [O43493-4]
NP_006455.2, NM_006464.3 [O43493-2]
UniGeneiHs.593382

Genome annotation databases

EnsembliENST00000282120; ENSP00000282120; ENSG00000152291 [O43493-1]
ENST00000377386; ENSP00000366603; ENSG00000152291 [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291 [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291 [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291 [O43493-5]
GeneIDi10618
KEGGihsa:10618
UCSCiuc002soz.4 human [O43493-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96906.1
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96907.1
AF029316
, AF029313, AF029314, AF029315 Genomic DNA Translation: AAB96908.1
U62390 mRNA Translation: AAC39539.1
AF027515 mRNA Translation: AAC39541.1
AF027516 mRNA Translation: AAC39542.1
X94333 mRNA Translation: CAA64002.1
AK126465 mRNA Translation: BAC86559.1
AK222829 mRNA Translation: BAD96549.1
AK223063 mRNA Translation: BAD96783.1
AK312479 mRNA Translation: BAG35383.1
BX640868 mRNA Translation: CAE45926.1
AC093162 Genomic DNA Translation: AAY24095.1
CH471053 Genomic DNA Translation: EAW99535.1
CH471053 Genomic DNA Translation: EAW99536.1
CH471053 Genomic DNA Translation: EAW99539.1
BC008461 mRNA Translation: AAH08461.1
BC028219 mRNA Translation: AAH28219.1
CCDSiCCDS46351.1 [O43493-2]
CCDS56126.1 [O43493-3]
CCDS56127.1 [O43493-4]
RefSeqiNP_001193769.1, NM_001206840.1
NP_001193770.1, NM_001206841.1
NP_001193773.1, NM_001206844.1 [O43493-4]
NP_006455.2, NM_006464.3 [O43493-2]
UniGeneiHs.593382

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115864, 52 interactors
IntActiO43493, 424 interactors
MINTiO43493
STRINGi9606.ENSP00000386443

PTM databases

iPTMnetiO43493
PhosphoSitePlusiO43493

Polymorphism and mutation databases

BioMutaiTGOLN2

Proteomic databases

EPDiO43493
PaxDbiO43493
PeptideAtlasiO43493
PRIDEiO43493
ProteomicsDBi48976
48977 [O43493-2]
48978 [O43493-3]
48979 [O43493-4]
48980 [O43493-5]
48981 [O43493-6]

Protocols and materials databases

DNASUi10618
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282120; ENSP00000282120; ENSG00000152291 [O43493-1]
ENST00000377386; ENSP00000366603; ENSG00000152291 [O43493-2]
ENST00000398263; ENSP00000381312; ENSG00000152291 [O43493-4]
ENST00000409232; ENSP00000386443; ENSG00000152291 [O43493-3]
ENST00000444342; ENSP00000391190; ENSG00000152291 [O43493-5]
GeneIDi10618
KEGGihsa:10618
UCSCiuc002soz.4 human [O43493-1]

Organism-specific databases

CTDi10618
DisGeNETi10618
EuPathDBiHostDB:ENSG00000152291.13
GeneCardsiTGOLN2
H-InvDBiHIX0022878
HGNCiHGNC:15450 TGOLN2
HPAiCAB011489
HPA012609
HPA012723
MIMi603062 gene
neXtProtiNX_O43493
OpenTargetsiENSG00000152291
PharmGKBiPA37959
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IXPE Eukaryota
ENOG410XUUR LUCA
GeneTreeiENSGT00530000064712
HOGENOMiHOG000089969
HOVERGENiHBG108564
InParanoidiO43493
OMAiEEQGPID
OrthoDBiEOG091G02UO
PhylomeDBiO43493
TreeFamiTF332514

Enzyme and pathway databases

ReactomeiR-HSA-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-432722 Golgi Associated Vesicle Biogenesis
R-HSA-6811440 Retrograde transport at the Trans-Golgi-Network
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8957275 Post-translational protein phosphorylation

Miscellaneous databases

ChiTaRSiTGOLN2 human
GeneWikiiTGOLN2
GenomeRNAii10618
PROiPR:O43493
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000152291 Expressed in 245 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiO43493 baseline and differential
GenevisibleiO43493 HS

Family and domain databases

InterProiView protein in InterPro
IPR026084 TGN38
PANTHERiPTHR23211 PTHR23211, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTGON2_HUMAN
AccessioniPrimary (citable) accession number: O43493
Secondary accession number(s): B2R686
, B8ZZ88, D6W5K3, F8W8W7, F8WBK2, J3KQ45, O15282, O43492, O43499, O43500, O43501, Q53G68, Q53GV2, Q6MZV1, Q6ZTM7, Q8N6T8, Q92760, Q96QL2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: March 28, 2018
Last modified: November 7, 2018
This is version 160 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again