Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase H

Gene

PPIH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding (PubMed:20676357). Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone.4 Publications

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).1 Publication

Activity regulationi

Inhibited by cyclosporin A.1 Publication

GO - Molecular functioni

  • cyclosporin A binding Source: UniProtKB
  • peptidyl-prolyl cis-trans isomerase activity Source: UniProtKB
  • ribonucleoprotein complex binding Source: BHF-UCL
  • unfolded protein binding Source: GO_Central

GO - Biological processi

  • mRNA splicing, via spliceosome Source: Reactome
  • positive regulation of viral genome replication Source: UniProtKB
  • protein-containing complex assembly Source: ProtInc
  • protein folding Source: ProtInc
  • protein peptidyl-prolyl isomerization Source: UniProtKB

Keywordsi

Molecular functionChaperone, Isomerase, Rotamase
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

BRENDAi5.2.1.8 2681
ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase H (EC:5.2.1.81 Publication)
Short name:
PPIase H
Alternative name(s):
Rotamase H
Small nuclear ribonucleoprotein particle-specific cyclophilin H
Short name:
CypH
U-snRNP-associated cyclophilin SnuCyp-20
Short name:
USA-CYP
Gene namesi
Name:PPIH
Synonyms:CYP20, CYPH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000171960.10
HGNCiHGNC:14651 PPIH
MIMi606095 gene
neXtProtiNX_O43447

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Spliceosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi133W → F: Abolishes inhibition by cyclosporin A. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000171960
PharmGKBiPA33586

Chemistry databases

DrugBankiDB00172 L-Proline

Polymorphism and mutation databases

BioMutaiPPIH

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000641622 – 177Peptidyl-prolyl cis-trans isomerase HAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO43447
PaxDbiO43447
PeptideAtlasiO43447
PRIDEiO43447
ProteomicsDBi48953

PTM databases

iPTMnetiO43447
PhosphoSitePlusiO43447

Expressioni

Gene expression databases

BgeeiENSG00000171960 Expressed in 226 organ(s), highest expression level in embryo
CleanExiHS_PPIH
ExpressionAtlasiO43447 baseline and differential
GenevisibleiO43447 HS

Organism-specific databases

HPAiHPA059019

Interactioni

Subunit structurei

Interacts directly with PRPF4. Part of a heteromeric complex containing PPIH, PRPF3 and PRPF4 that is stable in the absence of RNA. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39. Heterodimer with PRPF18.5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115728, 34 interactors
CORUMiO43447
IntActiO43447, 22 interactors
MINTiO43447
STRINGi9606.ENSP00000306614

Chemistry databases

BindingDBiO43447

Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO43447
SMRiO43447
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43447

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini14 – 176PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST163

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0546 Eukaryota
COG0652 LUCA
GeneTreeiENSGT00760000119072
HOGENOMiHOG000065981
HOVERGENiHBG001065
InParanoidiO43447
KOiK09567
OMAiPQGYKNA
OrthoDBiEOG091G0BGL
PhylomeDBiO43447
TreeFamiTF312958

Family and domain databases

Gene3Di2.40.100.10, 1 hit
InterProiView protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR024936 Cyclophilin-type_PPIase
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
PANTHERiPTHR11071 PTHR11071, 1 hit
PfamiView protein in Pfam
PF00160 Pro_isomerase, 1 hit
PIRSFiPIRSF001467 Peptidylpro_ismrse, 1 hit
PRINTSiPR00153 CSAPPISMRASE
SUPFAMiSSF50891 SSF50891, 1 hit
PROSITEiView protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43447-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE
60 70 80 90 100
FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF
110 120 130 140 150
KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV
160 170
MRKIENVPTG PNNKPKLPVV ISQCGEM
Length:177
Mass (Da):19,208
Last modified:June 1, 1998 - v1
Checksum:i566BCE6361E0F339
GO
Isoform 2 (identifier: O43447-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF → MIAGDSDR

Note: No experimental confirmation available.
Show »
Length:134
Mass (Da):14,492
Checksum:iE55350B73F8A1C3B
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JQD4C9JQD4_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIH
144Annotation score:
H0YEL5H0YEL5_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIH
96Annotation score:
C9JAN8C9JAN8_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIH
68Annotation score:
A6NM32A6NM32_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIH
57Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0565871 – 51MAVAN…CTGEF → MIAGDSDR in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF016371 mRNA Translation: AAC51927.1
AF036331 mRNA Translation: AAC60793.1
AK294288 mRNA Translation: BAH11725.1
AC098484 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07155.1
BC003412 mRNA Translation: AAH03412.1
CCDSiCCDS469.1 [O43447-1]
CCDS81308.1 [O43447-2]
RefSeqiNP_001317439.1, NM_001330510.1 [O43447-2]
NP_006338.1, NM_006347.3 [O43447-1]
XP_005270419.1, XM_005270362.1 [O43447-1]
XP_016855546.1, XM_017000057.1 [O43447-1]
XP_016855547.1, XM_017000058.1
XP_016855548.1, XM_017000059.1 [O43447-2]
UniGeneiHs.256639
Hs.729213

Genome annotation databases

EnsembliENST00000304979; ENSP00000306614; ENSG00000171960 [O43447-1]
ENST00000372550; ENSP00000361630; ENSG00000171960 [O43447-2]
GeneIDi10465
KEGGihsa:10465
UCSCiuc009vwl.3 human [O43447-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF016371 mRNA Translation: AAC51927.1
AF036331 mRNA Translation: AAC60793.1
AK294288 mRNA Translation: BAH11725.1
AC098484 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07155.1
BC003412 mRNA Translation: AAH03412.1
CCDSiCCDS469.1 [O43447-1]
CCDS81308.1 [O43447-2]
RefSeqiNP_001317439.1, NM_001330510.1 [O43447-2]
NP_006338.1, NM_006347.3 [O43447-1]
XP_005270419.1, XM_005270362.1 [O43447-1]
XP_016855546.1, XM_017000057.1 [O43447-1]
XP_016855547.1, XM_017000058.1
XP_016855548.1, XM_017000059.1 [O43447-2]
UniGeneiHs.256639
Hs.729213

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MZWX-ray2.00A1-177[»]
1QOIX-ray2.00A1-177[»]
5O9Zelectron microscopy4.50M1-177[»]
ProteinModelPortaliO43447
SMRiO43447
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115728, 34 interactors
CORUMiO43447
IntActiO43447, 22 interactors
MINTiO43447
STRINGi9606.ENSP00000306614

Chemistry databases

BindingDBiO43447
DrugBankiDB00172 L-Proline

PTM databases

iPTMnetiO43447
PhosphoSitePlusiO43447

Polymorphism and mutation databases

BioMutaiPPIH

Proteomic databases

EPDiO43447
PaxDbiO43447
PeptideAtlasiO43447
PRIDEiO43447
ProteomicsDBi48953

Protocols and materials databases

DNASUi10465
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304979; ENSP00000306614; ENSG00000171960 [O43447-1]
ENST00000372550; ENSP00000361630; ENSG00000171960 [O43447-2]
GeneIDi10465
KEGGihsa:10465
UCSCiuc009vwl.3 human [O43447-1]

Organism-specific databases

CTDi10465
EuPathDBiHostDB:ENSG00000171960.10
GeneCardsiPPIH
HGNCiHGNC:14651 PPIH
HPAiHPA059019
MIMi606095 gene
neXtProtiNX_O43447
OpenTargetsiENSG00000171960
PharmGKBiPA33586
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0546 Eukaryota
COG0652 LUCA
GeneTreeiENSGT00760000119072
HOGENOMiHOG000065981
HOVERGENiHBG001065
InParanoidiO43447
KOiK09567
OMAiPQGYKNA
OrthoDBiEOG091G0BGL
PhylomeDBiO43447
TreeFamiTF312958

Enzyme and pathway databases

BRENDAi5.2.1.8 2681
ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Miscellaneous databases

ChiTaRSiPPIH human
EvolutionaryTraceiO43447
GeneWikiiPPIH
GenomeRNAii10465
PROiPR:O43447
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171960 Expressed in 226 organ(s), highest expression level in embryo
CleanExiHS_PPIH
ExpressionAtlasiO43447 baseline and differential
GenevisibleiO43447 HS

Family and domain databases

Gene3Di2.40.100.10, 1 hit
InterProiView protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR024936 Cyclophilin-type_PPIase
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
PANTHERiPTHR11071 PTHR11071, 1 hit
PfamiView protein in Pfam
PF00160 Pro_isomerase, 1 hit
PIRSFiPIRSF001467 Peptidylpro_ismrse, 1 hit
PRINTSiPR00153 CSAPPISMRASE
SUPFAMiSSF50891 SSF50891, 1 hit
PROSITEiView protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPPIH_HUMAN
AccessioniPrimary (citable) accession number: O43447
Secondary accession number(s): A6NNE7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: June 1, 1998
Last modified: November 7, 2018
This is version 170 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again