Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Eukaryotic translation elongation factor 1 epsilon-1

Gene

EEF1E1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Positive modulator of ATM response to DNA damage.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processProtein biosynthesis

Enzyme and pathway databases

ReactomeiR-HSA-2408517 SeMet incorporation into proteins
R-HSA-379716 Cytosolic tRNA aminoacylation
SignaLinkiO43324

Names & Taxonomyi

Protein namesi
Recommended name:
Eukaryotic translation elongation factor 1 epsilon-1
Alternative name(s):
Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
Elongation factor p18
Multisynthase complex auxiliary component p181 Publication
Gene namesi
Name:EEF1E1
Synonyms:AIMP3, P181 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000124802.11
HGNCiHGNC:3212 EEF1E1
MIMi609206 gene
neXtProtiNX_O43324

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi69A → R: Disrupts interaction with MARS. 1 Publication1
Mutagenesisi73Q → R: Disrupts interaction with MARS. 1 Publication1
Mutagenesisi144R → A: Disrupts interaction with EPRS. 1 Publication1

Organism-specific databases

DisGeNETi9521
OpenTargetsiENSG00000124802
PharmGKBiPA27648

Polymorphism and mutation databases

BioMutaiEEF1E1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00002211322 – 174Eukaryotic translation elongation factor 1 epsilon-1Add BLAST173

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanine1 Publication1
Modified residuei138N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO43324
MaxQBiO43324
PaxDbiO43324
PeptideAtlasiO43324
PRIDEiO43324
ProteomicsDBi48904
TopDownProteomicsiO43324-1 [O43324-1]
O43324-2 [O43324-2]

PTM databases

iPTMnetiO43324
PhosphoSitePlusiO43324
SwissPalmiO43324

Expressioni

Tissue specificityi

Down-regulated in various cancer tissues.1 Publication

Inductioni

By DNA damaging agents such as UV, adriamycin, actinomycin-D and cisplatin.

Gene expression databases

BgeeiENSG00000124802
CleanExiHS_EEF1E1
ExpressionAtlasiO43324 baseline and differential
GenevisibleiO43324 HS

Organism-specific databases

HPAiHPA027901
HPA057866

Interactioni

Subunit structurei

Part of a multisubunit complex that groups tRNA ligases for Arg (RARS), Asp (DARS), Gln (QARS), Ile (IARS), Leu (LARS), Lys (KARS), Met (MARS) the bifunctional ligase for Glu and Pro (EPRS) and the auxiliary subunits AIMP1/p43, AIMP2/p38 and EEF1E1/p18 (PubMed:19131329, PubMed:19289464). Can interact simultaneously with MARS and EPRS (PubMed:26472928). Forms a linear complex that contains MARS, EEF1E1, EPRS and AIMP2 that is at the core of the multisubunit complex (PubMed:26472928). Interacts with ATM and ATR. The interaction with ATM, which takes place independently of TP53, is induced by DNA damage that may occur during genotoxic stress or cell growth. The interaction with ATR is enhanced by UV irradiation.4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi114898, 57 interactors
CORUMiO43324
DIPiDIP-50581N
IntActiO43324, 17 interactors
MINTiO43324
STRINGi9606.ENSP00000369038

Structurei

Secondary structure

1174
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 14Combined sources12
Beta strandi22 – 25Combined sources4
Turni26 – 29Combined sources4
Beta strandi30 – 34Combined sources5
Beta strandi36 – 39Combined sources4
Beta strandi40 – 43Combined sources4
Helixi44 – 54Combined sources11
Helixi58 – 61Combined sources4
Helixi65 – 80Combined sources16
Turni81 – 84Combined sources4
Helixi85 – 101Combined sources17
Helixi102 – 104Combined sources3
Beta strandi110 – 112Combined sources3
Helixi115 – 128Combined sources14
Helixi133 – 138Combined sources6
Helixi140 – 151Combined sources12
Turni153 – 155Combined sources3

3D structure databases

ProteinModelPortaliO43324
SMRiO43324
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43324

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 173GST C-terminalAdd BLAST124

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 56N-terminalAdd BLAST55
Regioni57 – 63Linker7
Regioni64 – 152C-terminalAdd BLAST89

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili153 – 1691 PublicationAdd BLAST17

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0867 Eukaryota
COG0625 LUCA
GeneTreeiENSGT00390000003564
HOGENOMiHOG000026786
HOVERGENiHBG003019
InParanoidiO43324
KOiK15439
OMAiDGHSSKD
OrthoDBiEOG091G0VQB
PhylomeDBiO43324
TreeFamiTF326005

Family and domain databases

InterProiView protein in InterPro
IPR010987 Glutathione-S-Trfase_C-like
IPR036282 Glutathione-S-Trfase_C_sf
IPR004046 GST_C
PfamiView protein in Pfam
PF00043 GST_C, 1 hit
SUPFAMiSSF47616 SSF47616, 1 hit
PROSITEiView protein in PROSITE
PS50405 GST_CTER, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O43324-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAELSLL EKSLGLSKGN KYSAQGERQI PVLQTNNGPS LTGLTTIAAH
60 70 80 90 100
LVKQANKEYL LGSTAEEKAI VQQWLEYRVT QVDGHSSKND IHTLLKDLNS
110 120 130 140 150
YLEDKVYLTG YNFTLADILL YYGLHRFIVD LTVQEKEKYL NVSRWFCHIQ
160 170
HYPGIRQHLS SVVFIKNRLY TNSH
Length:174
Mass (Da):19,811
Last modified:June 1, 1998 - v1
Checksum:i58AAE4BD9E1684E2
GO
Isoform 2 (identifier: O43324-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-174: VDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH → IRKLRHTEVGN

Note: No experimental confirmation available.
Show »
Length:139
Mass (Da):15,548
Checksum:iE11E55B587974D5C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045088129 – 174VDLTV…YTNSH → IRKLRHTEVGN in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011079 mRNA Translation: BAA24926.1
AF054186 mRNA Translation: AAC39916.1
BT007306 mRNA Translation: AAP35970.1
AL355499 Genomic DNA No translation available.
AL023694 Genomic DNA No translation available.
AL451187 Genomic DNA No translation available.
BC005291 mRNA Translation: AAH05291.1
CK002875 mRNA No translation available.
CCDSiCCDS4507.1 [O43324-1]
CCDS47370.1 [O43324-2]
RefSeqiNP_001129122.1, NM_001135650.1 [O43324-2]
NP_004271.1, NM_004280.4 [O43324-1]
UniGeneiHs.602353
Hs.745033

Genome annotation databases

EnsembliENST00000379715; ENSP00000369038; ENSG00000124802 [O43324-1]
ENST00000429723; ENSP00000414363; ENSG00000124802 [O43324-2]
GeneIDi9521
KEGGihsa:9521
UCSCiuc003mxz.4 human [O43324-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMCA3_HUMAN
AccessioniPrimary (citable) accession number: O43324
Secondary accession number(s): C9JLK5, Q5THS2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: June 1, 1998
Last modified: July 18, 2018
This is version 169 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health