Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43303 (CP110_HUMAN)

Protein

Centriolar coiled-coil protein of 110 kDa

Gene

CCP110

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Necessary for centrosome duplication at different stages of procentriole formation. Acts as a key negative regulator of ciliogenesis in collaboration with CEP97 by capping the mother centriole thereby preventing cilia formation (PubMed:17719545 PubMed:17681131, PubMed:23486064). Also involved in promoting ciliogenesis. May play a role in the assembly of the mother centriole subdistal appendages (SDA) thereby effecting the fusion of recycling endosomes to basal bodies during cilia formation (By similarity). Required for correct spindle formation and has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CETN2 (PubMed:16760425).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-5689880 Ub-specific processing proteases
R-HSA-8854518 AURKA Activation by TPX2

SIGNOR Signaling Network Open Resource

More...SIGNORi		O43303

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centriolar coiled-coil protein of 110 kDa
Alternative name(s):
Centrosomal protein of 110 kDa
Short name:
CP110
Short name:
Cep110
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCP110
Synonyms:CEP110, CP110, KIAA0419
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000103540.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:24342 CCP110

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609544 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43303

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi170S → A: Loss of centrosome clustering and protection from anaphase catastrophe upon CDK2 inhibition in lung cancer cells. 1 Publication1
Mutagenesisi194T → A: Loss of centrosome clustering and protection from anaphase catastrophe upon CDK2 inhibition in lung cancer cells. 1 Publication1
Mutagenesisi586 – 588RRL → ARA: Abolishes interaction with CCNF. 1 Publication3

Organism-specific databases

DisGeNET

More...DisGeNETi		9738

Open Targets

More...OpenTargetsi		ENSG00000103540

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCP110

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000894601 – 1012Centriolar coiled-coil protein of 110 kDaAdd BLAST1012

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei170Phosphoserine1 Publication1
Modified residuei194Phosphothreonine1 Publication1
Modified residuei366PhosphoserineBy similarity1
Modified residuei372PhosphoserineCombined sources1
Modified residuei400PhosphoserineBy similarity1
Modified residuei551PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CDKs.1 Publication
Ubiquitinated by the SCF(CCNF) during G2 phase, leading to its degradation by the proteasome and preventing centrosome reduplication. Deubiquitinated by USP33 in S and G2/M phase, leading to stabilize CCP110 during the period which centrioles duplicate and elongate.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43303

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43303

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43303

PeptideAtlas

More...PeptideAtlasi		O43303

PRoteomics IDEntifications database

More...PRIDEi		O43303

ProteomicsDB human proteome resource

More...ProteomicsDBi		48877
48878 [O43303-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43303

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43303

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during the transition from G1 to S phase of the cell cycle. The highest levels are observed in S phase, after which the levels decrease markedly.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000103540 Expressed in 219 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...CleanExi		HS_CEP110

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43303 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43303 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA039402

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CALM1, CETN2, CEP76, CEP97, CEP104, CEP290, TALPID3. Seems to associate with discrete CETN2, CEP97 and CEP290-containing complexes. Interacts with NEURL4 and CCNF; these interactions are not mutually exclusive and both lead to CCP110 ubiquitination and proteasome-dependent degradation. Via its interaction with NEURL4, may indirectly interact with HERC2. Interacts with KIF24, leading to its recruitment to centrioles. Interacts with USP20 and USP33.11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115087, 74 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O43303

Database of interacting proteins

More...DIPi		DIP-39892N

Protein interaction database and analysis system

More...IntActi		O43303, 65 interactors

Molecular INTeraction database

More...MINTi		O43303

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000370803

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O43303

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43303

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 223CEP97 bindingAdd BLAST223
Regioni64 – 82Calmodulin-bindingAdd BLAST19
Regioni67 – 82Required for interaction with CEP2901 PublicationAdd BLAST16
Regioni350 – 565Interaction with CEP761 PublicationAdd BLAST216
Regioni781 – 821Calmodulin-bindingAdd BLAST41
Regioni909 – 924Calmodulin-bindingAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili49 – 90Sequence analysisAdd BLAST42
Coiled coili640 – 709Sequence analysisAdd BLAST70

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IF00 Eukaryota
ENOG410XP98 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000004090

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG050873

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43303

KEGG Orthology (KO)

More...KOi		K16453

Identification of Orthologs from Complete Genome Data

More...OMAi		IPVRTGH

Database of Orthologous Groups

More...OrthoDBi		EOG091G0NCE

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43303

TreeFam database of animal gene trees

More...TreeFami		TF332788

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033207 CCP110

The PANTHER Classification System

More...PANTHERi		PTHR13594 PTHR13594, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43303-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEYEKFCEK SLARIQEASL STESFLPAQS ESISLIRFHG VAILSPLLNI 
        60         70         80         90        100
EKRKEMQQEK QKALDVEARK QVNRKKALLT RVQEILDNVQ VRKAPNASDF 
       110        120        130        140        150
DQWEMETVYS NSEVRNLNVP ATFPNSFPSH TEHSTAAKLD KIAGILPLDN 
       160        170        180        190        200
EDQCKTDGID LARDSEGFNS PKQCDSSNIS HVENEAFPKT SSATPQETLI 
       210        220        230        240        250
SDGPFSVNEQ QDLPLLAEVI PDPYVMSLQN LMKKSKEYIE REQSRRSLRG 
       260        270        280        290        300
SINRIVNESH LDKEHDAVEV ADCVKEKGQL TGKHCVSVIP DKPSLNKSNV 
       310        320        330        340        350
LLQGASTQAS SMSMPVLASF SKVDIPIRTG HPTVLESNSD FKVIPTFVTE 
       360        370        380        390        400
NNVIKSLTGS YAKLPSPEPS MSPKMHRRRS RTSSACHILI NNPINACELS 
       410        420        430        440        450
PKGKEQAMDL IIQDTDENTN VPEIMPKLPT DLAGVCSSKV YVGKNTSEVK 
       460        470        480        490        500
EDVVLGKSNQ VCQSSGNHLE NKVTHGLVTV EGQLTSDERG AHIMNSTCAA 
       510        520        530        540        550
MPKLHEPYAS SQCIASPNFG TVSGLKPASM LEKNCSLQTE LNKSYDVKNP 
       560        570        580        590        600
SPLLMQNQNT RQQMDTPMVS CGNEQFLDNS FEKVKRRLDL DIDGLQKENC 
       610        620        630        640        650
PYVITSGITE QERQHLPEKR YPKGSGFVNK NKMLGTSSKE SEELLKSKML 
       660        670        680        690        700
AFEEMRKRLE EQHAQQLSLL IAEQEREQER LQKEIEEQEK MLKEKKAMTA 
       710        720        730        740        750
EASELDINNA VELEWRKISD SSLLETMLSQ ADSLHTSNSN SSGFTNSAMQ 
       760        770        780        790        800
YSFVSANEAP FYLWGSSTSG LTKLSVTRPF GRAKTRWSQV FSLEIQAKFN 
       810        820        830        840        850
KITAVAKGFL TRRLMQTDKL KQLRQTVKDT MEFIRSFQSE APLKRGIVSA 
       860        870        880        890        900
QDASLQERVL AQLRAALYGI HDIFFVMDAA ERMSILHHDR EVRKEKMLRQ 
       910        920        930        940        950
MDKMKSPRVA LSAATQKSLD RKKYMKAAEM GMPNKKFLVK QNPSETRVLQ 
       960        970        980        990       1000
PNQGQNAPVH RLLSRQGTPK TSVKGVVQNR QKPSQSRVPN RVPVSGVYAG 
      1010 
KIQRKRPNVA TI
Length:1,012
Mass (Da):113,424
Last modified:October 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5459F655CFB9DFD0
GO
Isoform 2 (identifier: O43303-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     968-1012: TPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI → SICRKNPKKAAKCCDNLRRQHSLG

Show »
Length:991
Mass (Da):111,224
Checksum:iCDEA157BFDBC92EA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L262I3L262_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMS1H3BMS1_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BVH3H3BVH3_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA24849 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti628V → F in AAH36654 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05678869R → S. Corresponds to variant dbSNP:rs16972129Ensembl.1
Natural variantiVAR_056789171P → L. Corresponds to variant dbSNP:rs3751821EnsemblClinVar.1
Natural variantiVAR_019823252I → M4 PublicationsCorresponds to variant dbSNP:rs226891EnsemblClinVar.1
Natural variantiVAR_056790347F → I1 PublicationCorresponds to variant dbSNP:rs11645625Ensembl.1
Natural variantiVAR_019824375M → I. Corresponds to variant dbSNP:rs7190666EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011897968 – 1012TPKTS…NVATI → SICRKNPKKAAKCCDNLRRQ HSLG in isoform 2. 2 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB007879 mRNA Translation: BAA24849.2 Different initiation.
CR749255 mRNA Translation: CAH18111.1
AC003108 Genomic DNA Translation: AAC05804.1
AC012621 Genomic DNA No translation available.
BC036654 mRNA Translation: AAH36654.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10579.1 [O43303-2]
CCDS55992.1 [O43303-1]

Protein sequence database of the Protein Information Resource

More...PIRi		T01372

NCBI Reference Sequences

More...RefSeqi		NP_001185951.2, NM_001199022.2 [O43303-1]
NP_001310498.1, NM_001323569.1 [O43303-1]
NP_001310499.1, NM_001323570.1 [O43303-2]
NP_001310500.1, NM_001323571.1 [O43303-2]
NP_001310501.1, NM_001323572.1 [O43303-2]
NP_055526.4, NM_014711.5 [O43303-2]
XP_011544293.1, XM_011545991.2 [O43303-1]
XP_011544294.1, XM_011545992.2 [O43303-1]
XP_016879397.1, XM_017023908.1 [O43303-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.279912

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000381396; ENSP00000370803; ENSG00000103540 [O43303-1]
ENST00000396208; ENSP00000379511; ENSG00000103540 [O43303-2]
ENST00000396212; ENSP00000379515; ENSG00000103540 [O43303-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9738

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9738

UCSC genome browser

More...UCSCi		uc002dgk.5 human [O43303-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007879 mRNA Translation: BAA24849.2 Different initiation.
CR749255 mRNA Translation: CAH18111.1
AC003108 Genomic DNA Translation: AAC05804.1
AC012621 Genomic DNA No translation available.
BC036654 mRNA Translation: AAH36654.1
CCDSiCCDS10579.1 [O43303-2]
CCDS55992.1 [O43303-1]
PIRiT01372
RefSeqiNP_001185951.2, NM_001199022.2 [O43303-1]
NP_001310498.1, NM_001323569.1 [O43303-1]
NP_001310499.1, NM_001323570.1 [O43303-2]
NP_001310500.1, NM_001323571.1 [O43303-2]
NP_001310501.1, NM_001323572.1 [O43303-2]
NP_055526.4, NM_014711.5 [O43303-2]
XP_011544293.1, XM_011545991.2 [O43303-1]
XP_011544294.1, XM_011545992.2 [O43303-1]
XP_016879397.1, XM_017023908.1 [O43303-1]
UniGeneiHs.279912

3D structure databases

ProteinModelPortaliO43303
SMRiO43303
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115087, 74 interactors
CORUMiO43303
DIPiDIP-39892N
IntActiO43303, 65 interactors
MINTiO43303
STRINGi9606.ENSP00000370803

PTM databases

iPTMnetiO43303
PhosphoSitePlusiO43303

Polymorphism and mutation databases

BioMutaiCCP110

Proteomic databases

EPDiO43303
MaxQBiO43303
PaxDbiO43303
PeptideAtlasiO43303
PRIDEiO43303
ProteomicsDBi48877
48878 [O43303-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		9738
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381396; ENSP00000370803; ENSG00000103540 [O43303-1]
ENST00000396208; ENSP00000379511; ENSG00000103540 [O43303-2]
ENST00000396212; ENSP00000379515; ENSG00000103540 [O43303-2]
GeneIDi9738
KEGGihsa:9738
UCSCiuc002dgk.5 human [O43303-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9738
DisGeNETi9738
EuPathDBiHostDB:ENSG00000103540.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCP110
HGNCiHGNC:24342 CCP110
HPAiHPA039402
MIMi609544 gene
neXtProtiNX_O43303
OpenTargetsiENSG00000103540

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IF00 Eukaryota
ENOG410XP98 LUCA
GeneTreeiENSGT00390000004090
HOVERGENiHBG050873
InParanoidiO43303
KOiK16453
OMAiIPVRTGH
OrthoDBiEOG091G0NCE
PhylomeDBiO43303
TreeFamiTF332788

Enzyme and pathway databases

ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-5689880 Ub-specific processing proteases
R-HSA-8854518 AURKA Activation by TPX2
SIGNORiO43303

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCP110 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CCP110

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9738

Protein Ontology

More...PROi		PR:O43303

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000103540 Expressed in 219 organ(s), highest expression level in corpus callosum
CleanExiHS_CEP110
ExpressionAtlasiO43303 baseline and differential
GenevisibleiO43303 HS

Family and domain databases

InterProiView protein in InterPro
IPR033207 CCP110
PANTHERiPTHR13594 PTHR13594, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCP110_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43303
Secondary accession number(s): B7WP23
, O43335, Q68DV9, Q8NE13
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 23, 2007
Last modified: December 5, 2018
This is version 161 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again