Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centriolar coiled-coil protein of 110 kDa

Gene

CCP110

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Necessary for centrosome duplication at different stages of procentriole formation. Acts as a key negative regulator of ciliogenesis in collaboration with CEP97 by capping the mother centriole thereby preventing cilia formation (PubMed:17719545 PubMed:17681131, PubMed:23486064). Also involved in promoting ciliogenesis. May play a role in the assembly of the mother centriole subdistal appendages (SDA) thereby effecting the fusion of recycling endosomes to basal bodies during cilia formation (By similarity). Required for correct spindle formation and has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CETN2 (PubMed:16760425).By similarity5 Publications

GO - Biological processi

Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

ReactomeiR-HSA-2565942 Regulation of PLK1 Activity at G2/M Transition
R-HSA-380259 Loss of Nlp from mitotic centrosomes
R-HSA-380270 Recruitment of mitotic centrosome proteins and complexes
R-HSA-380284 Loss of proteins required for interphase microtubule organization from the centrosome
R-HSA-380320 Recruitment of NuMA to mitotic centrosomes
R-HSA-5620912 Anchoring of the basal body to the plasma membrane
R-HSA-5689880 Ub-specific processing proteases
R-HSA-8854518 AURKA Activation by TPX2
SIGNORiO43303

Names & Taxonomyi

Protein namesi
Recommended name:
Centriolar coiled-coil protein of 110 kDa
Alternative name(s):
Centrosomal protein of 110 kDa
Short name:
CP110
Short name:
Cep110
Gene namesi
Name:CCP110
Synonyms:CEP110, CP110, KIAA0419
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000103540.16
HGNCiHGNC:24342 CCP110
MIMi609544 gene
neXtProtiNX_O43303

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi170S → A: Loss of centrosome clustering and protection from anaphase catastrophe upon CDK2 inhibition in lung cancer cells. 1 Publication1
Mutagenesisi194T → A: Loss of centrosome clustering and protection from anaphase catastrophe upon CDK2 inhibition in lung cancer cells. 1 Publication1
Mutagenesisi586 – 588RRL → ARA: Abolishes interaction with CCNF. 1 Publication3

Organism-specific databases

DisGeNETi9738
OpenTargetsiENSG00000103540

Polymorphism and mutation databases

BioMutaiCCP110

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000894601 – 1012Centriolar coiled-coil protein of 110 kDaAdd BLAST1012

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei170Phosphoserine1 Publication1
Modified residuei194Phosphothreonine1 Publication1
Modified residuei366PhosphoserineBy similarity1
Modified residuei372PhosphoserineCombined sources1
Modified residuei400PhosphoserineBy similarity1
Modified residuei551PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by CDKs.1 Publication
Ubiquitinated by the SCF(CCNF) during G2 phase, leading to its degradation by the proteasome and preventing centrosome reduplication. Deubiquitinated by USP33 in S and G2/M phase, leading to stabilize CCP110 during the period which centrioles duplicate and elongate.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO43303
MaxQBiO43303
PaxDbiO43303
PeptideAtlasiO43303
PRIDEiO43303
ProteomicsDBi48877
48878 [O43303-2]

PTM databases

iPTMnetiO43303
PhosphoSitePlusiO43303

Expressioni

Tissue specificityi

Highly expressed in testis. Detected at intermediate levels in spleen, thymus, prostate, small intestine, colon and peripheral blood leukocytes.1 Publication

Inductioni

Up-regulated during the transition from G1 to S phase of the cell cycle. The highest levels are observed in S phase, after which the levels decrease markedly.1 Publication

Gene expression databases

BgeeiENSG00000103540 Expressed in 219 organ(s), highest expression level in corpus callosum
CleanExiHS_CEP110
ExpressionAtlasiO43303 baseline and differential
GenevisibleiO43303 HS

Organism-specific databases

HPAiHPA039402

Interactioni

Subunit structurei

Interacts with CALM1, CETN2, CEP76, CEP97, CEP104, CEP290, TALPID3. Seems to associate with discrete CETN2, CEP97 and CEP290-containing complexes. Interacts with NEURL4 and CCNF; these interactions are not mutually exclusive and both lead to CCP110 ubiquitination and proteasome-dependent degradation. Via its interaction with NEURL4, may indirectly interact with HERC2. Interacts with KIF24, leading to its recruitment to centrioles. Interacts with USP20 and USP33.11 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi115087, 73 interactors
CORUMiO43303
DIPiDIP-39892N
IntActiO43303, 64 interactors
MINTiO43303
STRINGi9606.ENSP00000370803

Structurei

3D structure databases

ProteinModelPortaliO43303
SMRiO43303
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 223CEP97 bindingAdd BLAST223
Regioni64 – 82Calmodulin-bindingAdd BLAST19
Regioni67 – 82Required for interaction with CEP2901 PublicationAdd BLAST16
Regioni350 – 565Interaction with CEP761 PublicationAdd BLAST216
Regioni781 – 821Calmodulin-bindingAdd BLAST41
Regioni909 – 924Calmodulin-bindingAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili49 – 90Sequence analysisAdd BLAST42
Coiled coili640 – 709Sequence analysisAdd BLAST70

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IF00 Eukaryota
ENOG410XP98 LUCA
GeneTreeiENSGT00390000004090
HOVERGENiHBG050873
InParanoidiO43303
KOiK16453
OMAiPSMSPKM
OrthoDBiEOG091G0NCE
PhylomeDBiO43303
TreeFamiTF332788

Family and domain databases

InterProiView protein in InterPro
IPR033207 CCP110
PANTHERiPTHR13594 PTHR13594, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: O43303-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEYEKFCEK SLARIQEASL STESFLPAQS ESISLIRFHG VAILSPLLNI
60 70 80 90 100
EKRKEMQQEK QKALDVEARK QVNRKKALLT RVQEILDNVQ VRKAPNASDF
110 120 130 140 150
DQWEMETVYS NSEVRNLNVP ATFPNSFPSH TEHSTAAKLD KIAGILPLDN
160 170 180 190 200
EDQCKTDGID LARDSEGFNS PKQCDSSNIS HVENEAFPKT SSATPQETLI
210 220 230 240 250
SDGPFSVNEQ QDLPLLAEVI PDPYVMSLQN LMKKSKEYIE REQSRRSLRG
260 270 280 290 300
SINRIVNESH LDKEHDAVEV ADCVKEKGQL TGKHCVSVIP DKPSLNKSNV
310 320 330 340 350
LLQGASTQAS SMSMPVLASF SKVDIPIRTG HPTVLESNSD FKVIPTFVTE
360 370 380 390 400
NNVIKSLTGS YAKLPSPEPS MSPKMHRRRS RTSSACHILI NNPINACELS
410 420 430 440 450
PKGKEQAMDL IIQDTDENTN VPEIMPKLPT DLAGVCSSKV YVGKNTSEVK
460 470 480 490 500
EDVVLGKSNQ VCQSSGNHLE NKVTHGLVTV EGQLTSDERG AHIMNSTCAA
510 520 530 540 550
MPKLHEPYAS SQCIASPNFG TVSGLKPASM LEKNCSLQTE LNKSYDVKNP
560 570 580 590 600
SPLLMQNQNT RQQMDTPMVS CGNEQFLDNS FEKVKRRLDL DIDGLQKENC
610 620 630 640 650
PYVITSGITE QERQHLPEKR YPKGSGFVNK NKMLGTSSKE SEELLKSKML
660 670 680 690 700
AFEEMRKRLE EQHAQQLSLL IAEQEREQER LQKEIEEQEK MLKEKKAMTA
710 720 730 740 750
EASELDINNA VELEWRKISD SSLLETMLSQ ADSLHTSNSN SSGFTNSAMQ
760 770 780 790 800
YSFVSANEAP FYLWGSSTSG LTKLSVTRPF GRAKTRWSQV FSLEIQAKFN
810 820 830 840 850
KITAVAKGFL TRRLMQTDKL KQLRQTVKDT MEFIRSFQSE APLKRGIVSA
860 870 880 890 900
QDASLQERVL AQLRAALYGI HDIFFVMDAA ERMSILHHDR EVRKEKMLRQ
910 920 930 940 950
MDKMKSPRVA LSAATQKSLD RKKYMKAAEM GMPNKKFLVK QNPSETRVLQ
960 970 980 990 1000
PNQGQNAPVH RLLSRQGTPK TSVKGVVQNR QKPSQSRVPN RVPVSGVYAG
1010
KIQRKRPNVA TI
Length:1,012
Mass (Da):113,424
Last modified:October 23, 2007 - v3
Checksum:i5459F655CFB9DFD0
GO
Isoform 2 (identifier: O43303-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     968-1012: TPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI → SICRKNPKKAAKCCDNLRRQHSLG

Show »
Length:991
Mass (Da):111,224
Checksum:iCDEA157BFDBC92EA
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L262I3L262_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
120Annotation score:
H3BMS1H3BMS1_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
50Annotation score:
H3BVH3H3BVH3_HUMAN
Centriolar coiled-coil protein of 1...
CCP110
52Annotation score:

Sequence cautioni

The sequence BAA24849 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti628V → F in AAH36654 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05678869R → S. Corresponds to variant dbSNP:rs16972129Ensembl.1
Natural variantiVAR_056789171P → L. Corresponds to variant dbSNP:rs3751821EnsemblClinVar.1
Natural variantiVAR_019823252I → M4 PublicationsCorresponds to variant dbSNP:rs226891EnsemblClinVar.1
Natural variantiVAR_056790347F → I1 PublicationCorresponds to variant dbSNP:rs11645625Ensembl.1
Natural variantiVAR_019824375M → I. Corresponds to variant dbSNP:rs7190666EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011897968 – 1012TPKTS…NVATI → SICRKNPKKAAKCCDNLRRQ HSLG in isoform 2. 2 PublicationsAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007879 mRNA Translation: BAA24849.2 Different initiation.
CR749255 mRNA Translation: CAH18111.1
AC003108 Genomic DNA Translation: AAC05804.1
AC012621 Genomic DNA No translation available.
BC036654 mRNA Translation: AAH36654.1
CCDSiCCDS10579.1 [O43303-2]
CCDS55992.1 [O43303-1]
PIRiT01372
RefSeqiNP_001185951.2, NM_001199022.2 [O43303-1]
NP_001310498.1, NM_001323569.1 [O43303-1]
NP_001310499.1, NM_001323570.1 [O43303-2]
NP_001310500.1, NM_001323571.1 [O43303-2]
NP_001310501.1, NM_001323572.1 [O43303-2]
NP_055526.4, NM_014711.5 [O43303-2]
XP_011544293.1, XM_011545991.2 [O43303-1]
XP_011544294.1, XM_011545992.2 [O43303-1]
XP_016879397.1, XM_017023908.1 [O43303-1]
UniGeneiHs.279912

Genome annotation databases

EnsembliENST00000381396; ENSP00000370803; ENSG00000103540 [O43303-1]
ENST00000396208; ENSP00000379511; ENSG00000103540 [O43303-2]
ENST00000396212; ENSP00000379515; ENSG00000103540 [O43303-2]
GeneIDi9738
KEGGihsa:9738
UCSCiuc002dgk.5 human [O43303-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCP110_HUMAN
AccessioniPrimary (citable) accession number: O43303
Secondary accession number(s): B7WP23
, O43335, Q68DV9, Q8NE13
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: October 23, 2007
Last modified: September 12, 2018
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again