Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SLIT-ROBO Rho GTPase-activating protein 3

Gene

SRGAP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase-activating protein for RAC1 and perhaps Cdc42, but not for RhoA small GTPase. May attenuate RAC1 signaling in neurons.2 Publications

GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • Rac GTPase binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1
SIGNORiO43295

Names & Taxonomyi

Protein namesi
Recommended name:
SLIT-ROBO Rho GTPase-activating protein 3
Short name:
srGAP3
Alternative name(s):
Mental disorder-associated GAP
Rho GTPase-activating protein 14
WAVE-associated Rac GTPase-activating protein
Short name:
WRP
Gene namesi
Name:SRGAP3
Synonyms:ARHGAP14, KIAA0411, KIAA1156, MEGAP, SRGAP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000196220.15
HGNCiHGNC:19744 SRGAP3
MIMi606525 gene
neXtProtiNX_O43295

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving SRGAP3 is found in a patient with severe idiopathic mental retardation (PubMed:12195014). Translocation t(X;3)(p11.2;p25) (PubMed:12195014).1 Publication

Organism-specific databases

DisGeNETi9901
MalaCardsiSRGAP3
OpenTargetsiENSG00000196220
Orphaneti251612 Pilocytic astrocytoma
PharmGKBiPA134935463

Polymorphism and mutation databases

BioMutaiSRGAP3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000567691 – 1099SLIT-ROBO Rho GTPase-activating protein 3Add BLAST1099

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei817PhosphoserineBy similarity1
Modified residuei820PhosphoserineBy similarity1
Modified residuei821PhosphoserineBy similarity1
Modified residuei837PhosphoserineCombined sources1
Modified residuei858PhosphoserineBy similarity1
Modified residuei954PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO43295
MaxQBiO43295
PaxDbiO43295
PeptideAtlasiO43295
PRIDEiO43295
ProteomicsDBi48867
48868 [O43295-2]
48869 [O43295-3]

PTM databases

iPTMnetiO43295
PhosphoSitePlusiO43295

Expressioni

Tissue specificityi

Highly expressed in adult and fetal brain. Expressed at low levels in kidney. Isoform 3 is expressed in the kidney but is absent in the brain.2 Publications

Gene expression databases

BgeeiENSG00000196220 Expressed in 171 organ(s), highest expression level in middle temporal gyrus
CleanExiHS_SRGAP2
HS_SRGAP3
ExpressionAtlasiO43295 baseline and differential
GenevisibleiO43295 HS

Organism-specific databases

HPAiHPA036959
HPA044074

Interactioni

Subunit structurei

Homodimer (Probable). Forms a heterooligomer with SRGAP1 and SRGAP2 through its F-BAR domain. Interacts with WASF1. Probably interacts with ROBO1. Interacts with FASLG.Curated3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115230, 21 interactors
IntActiO43295, 20 interactors
MINTiO43295
STRINGi9606.ENSP00000373347

Structurei

3D structure databases

ProteinModelPortaliO43295
SMRiO43295
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 314F-BARPROSITE-ProRule annotationAdd BLAST296
Domaini482 – 670Rho-GAPPROSITE-ProRule annotationAdd BLAST189
Domaini744 – 803SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili352 – 392Sequence analysisAdd BLAST41
Coiled coili952 – 987Sequence analysisAdd BLAST36

Domaini

The F-BAR domain mediates oligomerization, binds membranes, and induces plasma membrane protrusions.

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiKOG3565 Eukaryota
ENOG410XS44 LUCA
GeneTreeiENSGT00760000118863
HOGENOMiHOG000039980
HOVERGENiHBG051637
InParanoidiO43295
KOiK07526
OMAiLFNGCME
OrthoDBiEOG091G0113
PhylomeDBiO43295
TreeFamiTF315892

Family and domain databases

CDDicd11955 SH3_srGAP1-3, 1 hit
Gene3Di1.10.555.10, 1 hit
1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035648 srGAP1/2/3_SH3
PfamiView protein in Pfam
PF00611 FCH, 1 hit
PF00620 RhoGAP, 1 hit
PF00018 SH3_1, 1 hit
SMARTiView protein in SMART
SM00055 FCH, 1 hit
SM00324 RhoGAP, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF48350 SSF48350, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51741 F_BAR, 1 hit
PS50238 RHOGAP, 1 hit
PS50002 SH3, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O43295-1) [UniParc]FASTAAdd to basket
Also known as: MEGAPa, srGAP3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSQTKFKKD KEIIAEYEAQ IKEIRTQLVE QFKCLEQQSE SRLQLLQDLQ
60 70 80 90 100
EFFRRKAEIE LEYSRSLEKL AERFSSKIRS SREHQFKKDQ YLLSPVNCWY
110 120 130 140 150
LVLHQTRRES RDHATLNDIF MNNVIVRLSQ ISEDVIRLFK KSKEIGLQMH
160 170 180 190 200
EELLKVTNEL YTVMKTYHMY HAESISAESK LKEAEKQEEK QFNKSGDLSM
210 220 230 240 250
NLLRHEDRPQ RRSSVKKIEK MKEKRQAKYS ENKLKCTKAR NDYLLNLAAT
260 270 280 290 300
NAAISKYYIH DVSDLIDCCD LGFHASLART FRTYLSAEYN LETSRHEGLD
310 320 330 340 350
VIENAVDNLD SRSDKHTVMD MCNQVFCPPL KFEFQPHMGD EVCQVSAQQP
360 370 380 390 400
VQTELLMRYH QLQSRLATLK IENEEVRKTL DATMQTLQDM LTVEDFDVSD
410 420 430 440 450
AFQHSRSTES VKSAASETYM SKINIAKRRA NQQETEMFYF TKFKEYVNGS
460 470 480 490 500
NLITKLQAKH DLLKQTLGEG ERAECGTTRP PCLPPKPQKM RRPRPLSVYS
510 520 530 540 550
HKLFNGSMEA FIKDSGQAIP LVVESCIRYI NLYGLQQQGI FRVPGSQVEV
560 570 580 590 600
NDIKNSFERG EDPLVDDQNE RDINSVAGVL KLYFRGLENP LFPKERFQDL
610 620 630 640 650
ISTIKLENPA ERVHQIQQIL VTLPRVVIVV MRYLFAFLNH LSQYSDENMM
660 670 680 690 700
DPYNLAICFG PTLMHIPDGQ DPVSCQAHIN EVIKTIIIHH EAIFPSPREL
710 720 730 740 750
EGPVYEKCMA GGEEYCDSPH SEPGAIDEVD HDNGTEPHTS DEEVEQIEAI
760 770 780 790 800
AKFDYMGRSP RELSFKKGAS LLLYHRASED WWEGRHNGVD GLIPHQYIVV
810 820 830 840 850
QDMDDAFSDS LSQKADSEAS SGPLLDDKAS SKNDLQSPTE HISDYGFGGV
860 870 880 890 900
MGRVRLRSDG AAIPRRRSGG DTHSPPRGLG PSIDTPPRAA ACPSSPHKIP
910 920 930 940 950
LTRGRIESPE KRRMATFGSA GSINYPDKKA LSEGHSMRST CGSTRHSSLG
960 970 980 990 1000
DHKSLEAEAL AEDIEKTMST ALHELRELER QNTVKQAPDV VLDTLEPLKN
1010 1020 1030 1040 1050
PPGPVSSEPA SPLHTIVIRD PDAAMRRSSS SSTEMMTTFK PALSARLAGA
1060 1070 1080 1090
QLRPPPMRPV RPVVQHRSSS SSSSGVGSPA VTPTEKMFPN SSADKSGTM
Length:1,099
Mass (Da):124,504
Last modified:June 7, 2004 - v3
Checksum:i2D1BA2D338E1BF13
GO
Isoform 2 (identifier: O43295-2) [UniParc]FASTAAdd to basket
Also known as: MEGAPb, srGAP3b

The sequence of this isoform differs from the canonical sequence as follows:
     480-513: PPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIK → GRRNARTRNQ

Show »
Length:1,075
Mass (Da):121,780
Checksum:i442CA4D408B1F157
GO
Isoform 3 (identifier: O43295-3) [UniParc]FASTAAdd to basket
Also known as: MEGAPc, srGAP3c

The sequence of this isoform differs from the canonical sequence as follows:
     480-489: PPCLPPKPQK → IQDKLYRL
     490-1099: Missing.

Show »
Length:487
Mass (Da):57,227
Checksum:i1C99D701F9A3563B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WZH4A0A087WZH4_HUMAN
SLIT-ROBO Rho GTPase-activating pro...
SRGAP3
335Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035550623L → I in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_049159628I → V. Corresponds to variant dbSNP:rs2271207Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010581480 – 513PPCLP…EAFIK → GRRNARTRNQ in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_010582480 – 489PPCLPPKPQK → IQDKLYRL in isoform 3. Curated10
Alternative sequenceiVSP_010583490 – 1099Missing in isoform 3. CuratedAdd BLAST610

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464189 mRNA Translation: AAN57784.1
AF427144 mRNA Translation: AAN07095.1
AB007871 mRNA Translation: BAA24841.2
CCDSiCCDS2572.1 [O43295-1]
CCDS33689.1 [O43295-2]
RefSeqiNP_001028289.1, NM_001033117.2 [O43295-2]
NP_055665.1, NM_014850.3 [O43295-1]
UniGeneiHs.654743

Genome annotation databases

EnsembliENST00000360413; ENSP00000353587; ENSG00000196220 [O43295-2]
ENST00000383836; ENSP00000373347; ENSG00000196220 [O43295-1]
GeneIDi9901
KEGGihsa:9901
UCSCiuc003brf.4 human [O43295-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF464189 mRNA Translation: AAN57784.1
AF427144 mRNA Translation: AAN07095.1
AB007871 mRNA Translation: BAA24841.2
CCDSiCCDS2572.1 [O43295-1]
CCDS33689.1 [O43295-2]
RefSeqiNP_001028289.1, NM_001033117.2 [O43295-2]
NP_055665.1, NM_014850.3 [O43295-1]
UniGeneiHs.654743

3D structure databases

ProteinModelPortaliO43295
SMRiO43295
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115230, 21 interactors
IntActiO43295, 20 interactors
MINTiO43295
STRINGi9606.ENSP00000373347

PTM databases

iPTMnetiO43295
PhosphoSitePlusiO43295

Polymorphism and mutation databases

BioMutaiSRGAP3

Proteomic databases

EPDiO43295
MaxQBiO43295
PaxDbiO43295
PeptideAtlasiO43295
PRIDEiO43295
ProteomicsDBi48867
48868 [O43295-2]
48869 [O43295-3]

Protocols and materials databases

DNASUi9901
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360413; ENSP00000353587; ENSG00000196220 [O43295-2]
ENST00000383836; ENSP00000373347; ENSG00000196220 [O43295-1]
GeneIDi9901
KEGGihsa:9901
UCSCiuc003brf.4 human [O43295-1]

Organism-specific databases

CTDi9901
DisGeNETi9901
EuPathDBiHostDB:ENSG00000196220.15
GeneCardsiSRGAP3
HGNCiHGNC:19744 SRGAP3
HPAiHPA036959
HPA044074
MalaCardsiSRGAP3
MIMi606525 gene
neXtProtiNX_O43295
OpenTargetsiENSG00000196220
Orphaneti251612 Pilocytic astrocytoma
PharmGKBiPA134935463
HUGEiSearch...
Search...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3565 Eukaryota
ENOG410XS44 LUCA
GeneTreeiENSGT00760000118863
HOGENOMiHOG000039980
HOVERGENiHBG051637
InParanoidiO43295
KOiK07526
OMAiLFNGCME
OrthoDBiEOG091G0113
PhylomeDBiO43295
TreeFamiTF315892

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1
SIGNORiO43295

Miscellaneous databases

ChiTaRSiSRGAP3 human
GeneWikiiSRGAP3
GenomeRNAii9901
PROiPR:O43295
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196220 Expressed in 171 organ(s), highest expression level in middle temporal gyrus
CleanExiHS_SRGAP2
HS_SRGAP3
ExpressionAtlasiO43295 baseline and differential
GenevisibleiO43295 HS

Family and domain databases

CDDicd11955 SH3_srGAP1-3, 1 hit
Gene3Di1.10.555.10, 1 hit
1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR031160 F_BAR
IPR001060 FCH_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035648 srGAP1/2/3_SH3
PfamiView protein in Pfam
PF00611 FCH, 1 hit
PF00620 RhoGAP, 1 hit
PF00018 SH3_1, 1 hit
SMARTiView protein in SMART
SM00055 FCH, 1 hit
SM00324 RhoGAP, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
SSF48350 SSF48350, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS51741 F_BAR, 1 hit
PS50238 RHOGAP, 1 hit
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSRGP3_HUMAN
AccessioniPrimary (citable) accession number: O43295
Secondary accession number(s): Q8IX13, Q8IZV8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 7, 2004
Last modified: November 7, 2018
This is version 169 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again