Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - O43280 (TREA_HUMAN)

Entry version 171 (23 Feb 2022)
Sequence version 2 (23 Sep 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Trehalase

Gene

TREH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei168SubstrateBy similarity1
Binding sitei212SubstrateBy similarity1
Binding sitei319Substrate; via carbonyl oxygenBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei321Proton donor/acceptorBy similarity1
Active sitei514Proton donor/acceptorBy similarity1
Binding sitei529SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosidase, Hydrolase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.2.1.28, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43280

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-189085, Digestion of dietary carbohydrate

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O43280

Protein family/group databases

Carbohydrate-Active enZymes

More...CAZyi		GH37, Glycoside Hydrolase Family 37

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Trehalase1 Publication (EC:3.2.1.282 Publications)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TREHImported
Synonyms:TREA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:12266, TREH

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		275360, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43280

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000118094

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Trehalase deficiency (TREHD)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionAn autosomal recessive condition characterized by the inability to digest trehalose, a disaccharide found in mushrooms, products containing baker's yeast, and dried food. Individuals with trehalase deficiency suffer from abdominal pain, increased rectal flatulence, and diarrhea due to osmotic water flow into the colon.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		11181

MalaCards human disease database

More...MalaCardsi		TREH
MIMi612119, phenotype

Open Targets

More...OpenTargetsi		ENSG00000118094

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		103909, Trehalase deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36946

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43280, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3087

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TREH

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001205124 – 556TrehalaseAdd BLAST533
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000012052557 – 583Removed in mature formSequence analysisAdd BLAST27

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi78N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi239N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi261N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi369N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi556GPI-anchor amidated serineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43280

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43280

PeptideAtlas

More...PeptideAtlasi		O43280

PRoteomics IDEntifications database

More...PRIDEi		O43280

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48848 [O43280-1]
48849 [O43280-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O43280, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43280

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43280

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in kidney, liver and small intestine. Also more weakly expressed in pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000118094, Expressed in duodenum and 109 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43280, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43280, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000118094, Tissue enriched (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116351, 1 interactor

Protein interaction database and analysis system

More...IntActi		O43280, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000264029

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O43280

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43280, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43280

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni175 – 176Substrate bindingBy similarity2
Regioni221 – 223Substrate bindingBy similarity3
Regioni286 – 288Substrate bindingBy similarity3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0602, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000006949

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_006451_4_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43280

Identification of Orthologs from Complete Genome Data

More...OMAi		KVIDIWP

Database of Orthologous Groups

More...OrthoDBi		417479at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43280

TreeFam database of animal gene trees

More...TreeFami		TF314239

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.50.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008928, 6-hairpin_glycosidase_sf
IPR012341, 6hp_glycosidase-like_sf
IPR001661, Glyco_hydro_37
IPR018232, Glyco_hydro_37_CS

The PANTHER Classification System

More...PANTHERi		PTHR23403, PTHR23403, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01204, Trehalase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00744, GLHYDRLASE37

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48208, SSF48208, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00927, TREHALASE_1, 1 hit
PS00928, TREHALASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O43280-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD 
        60         70         80         90        100
DKQFVDMPLS IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE 
       110        120        130        140        150
LQPWTPADWK DSPQFLQKIS DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP 
       160        170        180        190        200
ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV MEGLLLSEMA ETVKGMLQNF 
       210        220        230        240        250
LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND TAFLQENIET 
       260        270        280        290        300
LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL 
       310        320        330        340        350
PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN 
       360        370        380        390        400
AFLCQAEELM SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF 
       410        420        430        440        450
DYDLEKKKKN REFYPSNLTP LWAGCFSDPG VADKALKYLE DNRILTYQYG 
       460        470        480        490        500
IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA KAPLRRAQEV AFQLAQNWIR 
       510        520        530        540        550
TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN GVVLMLLDRY 
       560        570        580 
GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW
Length:583
Mass (Da):66,568
Last modified:September 23, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3EE4D312B82185F9
GO
Isoform 2 (identifier: O43280-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C

Show »
Length:552
Mass (Da):62,941
Checksum:i09B87A62D49F49DF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTJ4A0A087WTJ4_HUMAN
Trehalase
TREH
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti539 – 540TN → DE in BAA24381 (PubMed:9427547).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049205389T → A. Corresponds to variant dbSNP:rs2276065Ensembl.1
Natural variantiVAR_049206449Y → H. Corresponds to variant dbSNP:rs11827611EnsemblClinVar.1
Natural variantiVAR_049207486R → W. Corresponds to variant dbSNP:rs2276064Ensembl.1
Natural variantiVAR_049208558A → P. Corresponds to variant dbSNP:rs6589671Ensembl.1
Natural variantiVAR_061191561A → P. Corresponds to variant dbSNP:rs6589670Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035440175 – 206WDSYW…DLVKT → C in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB000824 mRNA Translation: BAA24381.1
AK223140 mRNA Translation: BAD96860.1
AK223143 mRNA Translation: BAD96863.1
CH471065 Genomic DNA Translation: EAW67409.1
BC109206 mRNA Translation: AAI09207.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS73401.1 [O43280-2]
CCDS73402.1 [O43280-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JC6504

NCBI Reference Sequences

More...RefSeqi		NP_001287994.1, NM_001301065.1 [O43280-2]
NP_009111.2, NM_007180.2 [O43280-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264029; ENSP00000264029; ENSG00000118094
ENST00000397925; ENSP00000381020; ENSG00000118094 [O43280-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11181

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:11181

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000264029.9; ENSP00000264029.5; NM_007180.3; NP_009111.2

UCSC genome browser

More...UCSCi		uc031ygn.2, human [O43280-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Trehalase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA Translation: BAA24381.1
AK223140 mRNA Translation: BAD96860.1
AK223143 mRNA Translation: BAD96863.1
CH471065 Genomic DNA Translation: EAW67409.1
BC109206 mRNA Translation: AAI09207.1
CCDSiCCDS73401.1 [O43280-2]
CCDS73402.1 [O43280-1]
PIRiJC6504
RefSeqiNP_001287994.1, NM_001301065.1 [O43280-2]
NP_009111.2, NM_007180.2 [O43280-1]

3D structure databases

SMRiO43280
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116351, 1 interactor
IntActiO43280, 1 interactor
STRINGi9606.ENSP00000264029

Chemistry databases

BindingDBiO43280
ChEMBLiCHEMBL3087

Protein family/group databases

CAZyiGH37, Glycoside Hydrolase Family 37

PTM databases

GlyGeniO43280, 4 sites
iPTMnetiO43280
PhosphoSitePlusiO43280

Genetic variation databases

BioMutaiTREH

Proteomic databases

MassIVEiO43280
PaxDbiO43280
PeptideAtlasiO43280
PRIDEiO43280
ProteomicsDBi48848 [O43280-1]
48849 [O43280-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		48758, 123 antibodies from 20 providers

The DNASU plasmid repository

More...DNASUi		11181

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094
ENST00000397925; ENSP00000381020; ENSG00000118094 [O43280-2]
GeneIDi11181
KEGGihsa:11181
MANE-SelectiENST00000264029.9; ENSP00000264029.5; NM_007180.3; NP_009111.2
UCSCiuc031ygn.2, human [O43280-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11181
DisGeNETi11181

GeneCards: human genes, protein and diseases

More...GeneCardsi		TREH
HGNCiHGNC:12266, TREH
HPAiENSG00000118094, Tissue enriched (intestine)
MalaCardsiTREH
MIMi275360, gene
612119, phenotype
neXtProtiNX_O43280
OpenTargetsiENSG00000118094
Orphaneti103909, Trehalase deficiency
PharmGKBiPA36946
VEuPathDBiHostDB:ENSG00000118094

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0602, Eukaryota
GeneTreeiENSGT00390000006949
HOGENOMiCLU_006451_4_3_1
InParanoidiO43280
OMAiKVIDIWP
OrthoDBi417479at2759
PhylomeDBiO43280
TreeFamiTF314239

Enzyme and pathway databases

BRENDAi3.2.1.28, 2681
PathwayCommonsiO43280
ReactomeiR-HSA-189085, Digestion of dietary carbohydrate
SignaLinkiO43280

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11181, 5 hits in 280 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		11181
PharosiO43280, Tchem

Protein Ontology

More...PROi		PR:O43280
RNActiO43280, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000118094, Expressed in duodenum and 109 other tissues
ExpressionAtlasiO43280, baseline and differential
GenevisibleiO43280, HS

Family and domain databases

Gene3Di1.50.10.10, 1 hit
InterProiView protein in InterPro
IPR008928, 6-hairpin_glycosidase_sf
IPR012341, 6hp_glycosidase-like_sf
IPR001661, Glyco_hydro_37
IPR018232, Glyco_hydro_37_CS
PANTHERiPTHR23403, PTHR23403, 1 hit
PfamiView protein in Pfam
PF01204, Trehalase, 1 hit
PRINTSiPR00744, GLHYDRLASE37
SUPFAMiSSF48208, SSF48208, 1 hit
PROSITEiView protein in PROSITE
PS00927, TREHALASE_1, 1 hit
PS00928, TREHALASE_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTREA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43280
Secondary accession number(s): Q32MB9, Q53FY8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: February 23, 2022
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again