Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trehalase

Gene

TREH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.2 Publications

Catalytic activityi

Alpha,alpha-trehalose + H2O = beta-D-glucose + alpha-D-glucose.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei168SubstrateBy similarity1
Binding sitei212SubstrateBy similarity1
Binding sitei319Substrate; via carbonyl oxygenBy similarity1
Active sitei321Proton donor/acceptorBy similarity1
Active sitei514Proton donor/acceptorBy similarity1
Binding sitei529SubstrateBy similarity1

GO - Molecular functioni

  • alpha,alpha-trehalase activity Source: UniProtKB

GO - Biological processi

  • animal organ morphogenesis Source: Ensembl
  • trehalose catabolic process Source: UniProtKB
  • trehalose metabolic process Source: UniProtKB

Keywordsi

Molecular functionGlycosidase, Hydrolase

Enzyme and pathway databases

ReactomeiR-HSA-189085 Digestion of dietary carbohydrate

Protein family/group databases

CAZyiGH37 Glycoside Hydrolase Family 37

Names & Taxonomyi

Protein namesi
Recommended name:
Trehalase1 Publication (EC:3.2.1.282 Publications)
Alternative name(s):
Alpha,alpha-trehalase
Alpha,alpha-trehalose glucohydrolase
Gene namesi
Name:TREHImported
Synonyms:TREA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000118094.11
HGNCiHGNC:12266 TREH
MIMi275360 gene
neXtProtiNX_O43280

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Trehalase deficiency (TREHD)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionAn autosomal recessive condition characterized by the inability to digest trehalose, a disaccharide found in mushrooms, products containing baker's yeast, and dried food. Individuals with trehalase deficiency suffer from abdominal pain, increased rectal flatulence, and diarrhea due to osmotic water flow into the colon.
See also OMIM:612119

Organism-specific databases

DisGeNETi11181
MalaCardsiTREH
MIMi612119 phenotype
OpenTargetsiENSG00000118094
Orphaneti103909 Diarrhea-vomiting due to trehalase deficiency
PharmGKBiPA36946

Chemistry databases

ChEMBLiCHEMBL3087

Polymorphism and mutation databases

BioMutaiTREH

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001205124 – 556TrehalaseAdd BLAST533
PropeptideiPRO_0000012052557 – 583Removed in mature formSequence analysisAdd BLAST27

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi78N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi239N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi261N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi369N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Lipidationi556GPI-anchor amidated serineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiO43280
PeptideAtlasiO43280
PRIDEiO43280
ProteomicsDBi48848
48849 [O43280-2]

PTM databases

iPTMnetiO43280
PhosphoSitePlusiO43280

Expressioni

Tissue specificityi

Expressed in kidney, liver and small intestine. Also more weakly expressed in pancreas.1 Publication

Gene expression databases

BgeeiENSG00000118094 Expressed in 83 organ(s), highest expression level in jejunal mucosa
CleanExiHS_TREH
ExpressionAtlasiO43280 baseline and differential
GenevisibleiO43280 HS

Organism-specific databases

HPAiHPA039913
HPA042045

Interactioni

Subunit structurei

Homodimer; disulfide-linked.By similarity

Protein-protein interaction databases

BioGridi116351, 1 interactor
STRINGi9606.ENSP00000264029

Chemistry databases

BindingDBiO43280

Structurei

3D structure databases

ProteinModelPortaliO43280
SMRiO43280
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni175 – 176Substrate bindingBy similarity2
Regioni221 – 223Substrate bindingBy similarity3
Regioni286 – 288Substrate bindingBy similarity3

Sequence similaritiesi

Belongs to the glycosyl hydrolase 37 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0602 Eukaryota
COG1626 LUCA
GeneTreeiENSGT00390000006949
HOGENOMiHOG000215465
HOVERGENiHBG014956
InParanoidiO43280
KOiK01194
OMAiKYDISNG
OrthoDBiEOG091G0341
PhylomeDBiO43280
TreeFamiTF314239

Family and domain databases

Gene3Di1.50.10.10, 1 hit
InterProiView protein in InterPro
IPR008928 6-hairpin_glycosidase_sf
IPR012341 6hp_glycosidase-like_sf
IPR001661 Glyco_hydro_37
IPR018232 Glyco_hydro_37_CS
PANTHERiPTHR23403 PTHR23403, 1 hit
PfamiView protein in Pfam
PF01204 Trehalase, 1 hit
PRINTSiPR00744 GLHYDRLASE37
SUPFAMiSSF48208 SSF48208, 1 hit
PROSITEiView protein in PROSITE
PS00927 TREHALASE_1, 1 hit
PS00928 TREHALASE_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O43280-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGRTWELCL LLLLGLGLGS QEALPPPCES EIYCHGELLN QVQMAKLYQD
60 70 80 90 100
DKQFVDMPLS IAPEQVLQTF TELSRDHNHS IPREQLQAFV HEHFQAKGQE
110 120 130 140 150
LQPWTPADWK DSPQFLQKIS DAKLRAWAGQ LHQLWKKLGK KMKPEVLSHP
160 170 180 190 200
ERFSLIYSEH PFIVPGGRFV EFYYWDSYWV MEGLLLSEMA ETVKGMLQNF
210 220 230 240 250
LDLVKTYGHV PNGGRVYYLQ RSQPPLLTLM MDCYLTHTND TAFLQENIET
260 270 280 290 300
LALELDFWTK NRTVSVSLEG KNYLLNRYYV PYGGPRPESY SKDVELADTL
310 320 330 340 350
PEGDREALWA ELKAGAESGW DFSSRWLIGG PNPNSLSGIR TSKLVPVDLN
360 370 380 390 400
AFLCQAEELM SNFYSRLGND SQATKYRILR SQRLAALNTV LWDEQTGAWF
410 420 430 440 450
DYDLEKKKKN REFYPSNLTP LWAGCFSDPG VADKALKYLE DNRILTYQYG
460 470 480 490 500
IPTSLQKTGQ QWDFPNAWAP LQDLVIRGLA KAPLRRAQEV AFQLAQNWIR
510 520 530 540 550
TNFDVYSQKS AMYEKYDVSN GGQPGGGGEY EVQEGFGWTN GVVLMLLDRY
560 570 580
GDRLTSGAKL AFLEPHCLAA TLLPSLLLSL LPW
Length:583
Mass (Da):66,568
Last modified:September 23, 2008 - v2
Checksum:i3EE4D312B82185F9
GO
Isoform 2 (identifier: O43280-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-206: WDSYWVMEGLLLSEMAETVKGMLQNFLDLVKT → C

Note: No experimental confirmation available.
Show »
Length:552
Mass (Da):62,941
Checksum:i09B87A62D49F49DF
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTJ4A0A087WTJ4_HUMAN
Trehalase
TREH
37Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti539 – 540TN → DE in BAA24381 (PubMed:9427547).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049205389T → A. Corresponds to variant dbSNP:rs2276065Ensembl.1
Natural variantiVAR_049206449Y → H. Corresponds to variant dbSNP:rs11827611EnsemblClinVar.1
Natural variantiVAR_049207486R → W. Corresponds to variant dbSNP:rs2276064Ensembl.1
Natural variantiVAR_049208558A → P. Corresponds to variant dbSNP:rs6589671Ensembl.1
Natural variantiVAR_061191561A → P. Corresponds to variant dbSNP:rs6589670Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035440175 – 206WDSYW…DLVKT → C in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA Translation: BAA24381.1
AK223140 mRNA Translation: BAD96860.1
AK223143 mRNA Translation: BAD96863.1
CH471065 Genomic DNA Translation: EAW67409.1
BC109206 mRNA Translation: AAI09207.1
CCDSiCCDS73401.1 [O43280-2]
CCDS73402.1 [O43280-1]
PIRiJC6504
RefSeqiNP_001287994.1, NM_001301065.1 [O43280-2]
NP_009111.2, NM_007180.2 [O43280-1]
UniGeneiHs.129712

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094 [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094 [O43280-2]
GeneIDi11181
KEGGihsa:11181
UCSCiuc031ygn.2 human [O43280-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Trehalase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB000824 mRNA Translation: BAA24381.1
AK223140 mRNA Translation: BAD96860.1
AK223143 mRNA Translation: BAD96863.1
CH471065 Genomic DNA Translation: EAW67409.1
BC109206 mRNA Translation: AAI09207.1
CCDSiCCDS73401.1 [O43280-2]
CCDS73402.1 [O43280-1]
PIRiJC6504
RefSeqiNP_001287994.1, NM_001301065.1 [O43280-2]
NP_009111.2, NM_007180.2 [O43280-1]
UniGeneiHs.129712

3D structure databases

ProteinModelPortaliO43280
SMRiO43280
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116351, 1 interactor
STRINGi9606.ENSP00000264029

Chemistry databases

BindingDBiO43280
ChEMBLiCHEMBL3087

Protein family/group databases

CAZyiGH37 Glycoside Hydrolase Family 37

PTM databases

iPTMnetiO43280
PhosphoSitePlusiO43280

Polymorphism and mutation databases

BioMutaiTREH

Proteomic databases

PaxDbiO43280
PeptideAtlasiO43280
PRIDEiO43280
ProteomicsDBi48848
48849 [O43280-2]

Protocols and materials databases

DNASUi11181
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264029; ENSP00000264029; ENSG00000118094 [O43280-1]
ENST00000397925; ENSP00000381020; ENSG00000118094 [O43280-2]
GeneIDi11181
KEGGihsa:11181
UCSCiuc031ygn.2 human [O43280-1]

Organism-specific databases

CTDi11181
DisGeNETi11181
EuPathDBiHostDB:ENSG00000118094.11
GeneCardsiTREH
H-InvDBiHIX0010188
HGNCiHGNC:12266 TREH
HPAiHPA039913
HPA042045
MalaCardsiTREH
MIMi275360 gene
612119 phenotype
neXtProtiNX_O43280
OpenTargetsiENSG00000118094
Orphaneti103909 Diarrhea-vomiting due to trehalase deficiency
PharmGKBiPA36946
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0602 Eukaryota
COG1626 LUCA
GeneTreeiENSGT00390000006949
HOGENOMiHOG000215465
HOVERGENiHBG014956
InParanoidiO43280
KOiK01194
OMAiKYDISNG
OrthoDBiEOG091G0341
PhylomeDBiO43280
TreeFamiTF314239

Enzyme and pathway databases

ReactomeiR-HSA-189085 Digestion of dietary carbohydrate

Miscellaneous databases

GenomeRNAii11181
PROiPR:O43280
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000118094 Expressed in 83 organ(s), highest expression level in jejunal mucosa
CleanExiHS_TREH
ExpressionAtlasiO43280 baseline and differential
GenevisibleiO43280 HS

Family and domain databases

Gene3Di1.50.10.10, 1 hit
InterProiView protein in InterPro
IPR008928 6-hairpin_glycosidase_sf
IPR012341 6hp_glycosidase-like_sf
IPR001661 Glyco_hydro_37
IPR018232 Glyco_hydro_37_CS
PANTHERiPTHR23403 PTHR23403, 1 hit
PfamiView protein in Pfam
PF01204 Trehalase, 1 hit
PRINTSiPR00744 GLHYDRLASE37
SUPFAMiSSF48208 SSF48208, 1 hit
PROSITEiView protein in PROSITE
PS00927 TREHALASE_1, 1 hit
PS00928 TREHALASE_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTREA_HUMAN
AccessioniPrimary (citable) accession number: O43280
Secondary accession number(s): Q32MB9, Q53FY8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: September 23, 2008
Last modified: September 12, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Glycosyl hydrolases
    Classification of glycosyl hydrolase families and list of entries
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again