Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA binding protein fox-1 homolog 2

Gene

RBFOX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.By similarity1 Publication

GO - Molecular functioni

  • mRNA binding Source: GO_Central
  • RNA binding Source: UniProtKB
  • transcription corepressor activity Source: UniProtKB
  • transcription factor binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

ReactomeiR-HSA-6803529 FGFR2 alternative splicing

Names & Taxonomyi

Protein namesi
Recommended name:
RNA binding protein fox-1 homolog 2
Alternative name(s):
Fox-1 homolog B
Hexaribonucleotide-binding protein 2
RNA-binding motif protein 9
RNA-binding protein 9
Repressor of tamoxifen transcriptional activity
Gene namesi
Name:RBFOX2
Synonyms:FOX2, HRNBP2, RBM9, RTA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100320.22
HGNCiHGNC:9906 RBFOX2
MIMi612149 gene
neXtProtiNX_O43251

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23543
OpenTargetsiENSG00000100320
PharmGKBiPA34272

Polymorphism and mutation databases

BioMutaiRBFOX2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817661 – 390RNA binding protein fox-1 homolog 2Add BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei281Omega-N-methylarginineBy similarity1
Modified residuei297Asymmetric dimethylarginineBy similarity1
Modified residuei329Asymmetric dimethylarginineCombined sources1
Modified residuei381Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei381Omega-N-methylarginine; alternateBy similarity1
Modified residuei386Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei386Omega-N-methylarginine; alternateBy similarity1
Isoform 6 (identifier: O43251-6)
Modified residuei67PhosphothreonineCombined sourcesCurated1
Isoform 8 (identifier: O43251-8)
Modified residuei67PhosphothreonineCombined sources1
Isoform 3 (identifier: O43251-3)
Modified residuei249Omega-N-methylarginineCombined sources1
Isoform 5 (identifier: O43251-5)
Modified residuei267Omega-N-methylarginineCombined sources1
Isoform 9 (identifier: O43251-9)
Modified residuei268Omega-N-methylarginineCombined sources1
Isoform 7 (identifier: O43251-7)
Modified residuei277Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiO43251
MaxQBiO43251
PaxDbiO43251
PeptideAtlasiO43251
PRIDEiO43251
ProteomicsDBi48827
48828 [O43251-10]
48829 [O43251-2]
48830 [O43251-3]
48831 [O43251-4]
48832 [O43251-5]
48833 [O43251-6]
48834 [O43251-7]
48835 [O43251-8]
48836 [O43251-9]

PTM databases

iPTMnetiO43251
PhosphoSitePlusiO43251

Expressioni

Gene expression databases

BgeeiENSG00000100320 Expressed in 240 organ(s), highest expression level in frontal cortex
CleanExiHS_RBM9
ExpressionAtlasiO43251 baseline and differential
GenevisibleiO43251 HS

Organism-specific databases

HPAiHPA006240

Interactioni

Subunit structurei

Interacts with ER-alpha N-terminal activation domain.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei122Interaction with RNABy similarity1
Sitei130Interaction with RNABy similarity1
Sitei131Interaction with RNABy similarity1
Sitei155Interaction with RNABy similarity1
Sitei160Interaction with RNABy similarity1
Sitei164Interaction with RNABy similarity1
Sitei188Interaction with RNABy similarity1
Sitei198Interaction with RNABy similarity1

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi117087, 160 interactors
IntActiO43251, 72 interactors
MINTiO43251
STRINGi9606.ENSP00000413035

Structurei

Secondary structure

1390
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliO43251
SMRiO43251
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO43251

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini121 – 197RRMPROSITE-ProRule annotationAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi273 – 377Ala-richAdd BLAST105

Phylogenomic databases

eggNOGiKOG0125 Eukaryota
ENOG4111WJT LUCA
GeneTreeiENSGT00390000013767
HOVERGENiHBG000044
InParanoidiO43251
KOiK14946
OMAiPARDSQX
OrthoDBiEOG091G15X5
PhylomeDBiO43251
TreeFamiTF315942

Family and domain databases

CDDicd12407 RRM_FOX1_like, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR025670 Fox-1_C_dom
IPR034237 FOX1_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR017325 RNA-bd_Fox-1
IPR000504 RRM_dom
PfamiView protein in Pfam
PF12414 Fox-1_C, 1 hit
PF00076 RRM_1, 1 hit
PIRSFiPIRSF037932 Ataxin_2_bd_A2BP, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

Sequences (10+)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43251-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQNEPLTPGY HGFPARDSQG NQEPTTTPDA MVQPFTTIPF PPPPQNGIPT
60 70 80 90 100
EYGVPHTQDY AGQTGEHNLT LYGSTQAHGE QSSNSPSTQN GSLTTEGGAQ
110 120 130 140 150
TDGQQSQTQS SENSESKSTP KRLHVSNIPF RFRDPDLRQM FGQFGKILDV
160 170 180 190 200
EIIFNERGSK GFGFVTFENS ADADRAREKL HGTVVEGRKI EVNNATARVM
210 220 230 240 250
TNKKMVTPYA NGWKLSPVVG AVYGPELYAA SSFQADVSLG NDAAVPLSGR
260 270 280 290 300
GGINTYIPLI SLPLVPGFPY PTAATTAAAF RGAHLRGRGR TVYGAVRAVP
310 320 330 340 350
PTAIPAYPGV VYQDGFYGAD LYGGYAAYRY AQPATATAAT AAAAAAAAYS
360 370 380 390
DGYGRVYTAD PYHALAPAAS YGVGAVASLY RGGYSRFAPY
Length:390
Mass (Da):41,374
Last modified:April 11, 2003 - v3
Checksum:i40D6C8C40764B317
GO
Isoform 2 (identifier: O43251-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ

Show »
Length:381
Mass (Da):40,479
Checksum:i553FE52BD48F7062
GO
Isoform 3 (identifier: O43251-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     143-160: Missing.
     261-265: SLPLV → I

Note: No experimental confirmation available.Combined sources
Show »
Length:358
Mass (Da):37,879
Checksum:iBA4B3740D2DA6E7A
GO
Isoform 4 (identifier: O43251-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Note: No experimental confirmation available.
Show »
Length:370
Mass (Da):39,783
Checksum:i725D8B1C719AEB10
GO
Isoform 5 (identifier: O43251-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     261-265: SLPLV → I

Note: No experimental confirmation available.Combined sources
Show »
Length:376
Mass (Da):39,954
Checksum:iA50D5086B4436165
GO
Isoform 6 (identifier: O43251-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM

Show »
Length:450
Mass (Da):47,215
Checksum:i56D559291EF61ECF
GO
Isoform 7 (identifier: O43251-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-265: SLPLV → I
     323-390: GGYAAYRYAQ...RGGYSRFAPY → IESANCFRSN...TADLPPTEVT

Show »
Length:400
Mass (Da):43,179
Checksum:i6A4D8B3E2FAA5726
GO
Isoform 8 (identifier: O43251-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM
     94-94: T → TQ

Show »
Length:451
Mass (Da):47,343
Checksum:iF4E92F3CCC76447B
GO
Isoform 9 (identifier: O43251-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ
     261-265: SLPLV → I
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Show »
Length:367
Mass (Da):39,515
Checksum:i7A2C1824C39B7FA4
GO
Isoform 10 (identifier: O43251-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT

Show »
Length:380
Mass (Da):40,351
Checksum:i601F4E31E7C20715
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B0QYY4B0QYY4_HUMAN
RNA binding protein fox-1 homolog
RBFOX2
370Annotation score:
B0QYV1B0QYV1_HUMAN
RNA binding protein fox-1 homolog
RBFOX2
357Annotation score:
B0QYY7B0QYY7_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
200Annotation score:
S4R469S4R469_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
234Annotation score:
B0QYY6B0QYY6_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
128Annotation score:
A0A0G2JRA5A0A0G2JRA5_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
389Annotation score:
S4R3K7S4R3K7_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
230Annotation score:
A0A0G2JSB3A0A0G2JSB3_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
186Annotation score:
A0A0G2JRD1A0A0G2JRD1_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
227Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti116S → G in AAX84843 (PubMed:14702039).Curated1
Sequence conflicti231S → F in BAB70875 (PubMed:12529303).Curated1
Sequence conflicti346A → V in AAH13115 (PubMed:15489334).Curated1
Sequence conflicti350S → G in BAB70875 (PubMed:12529303).Curated1
Isoform 6 (identifier: O43251-6)
Sequence conflicti8H → Q in BAB70875 (PubMed:12529303).Combined sourcesCurated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0071801 – 18MQNEP…PARDS → MEKKKMVT in isoform 2, isoform 3, isoform 4, isoform 5, isoform 9 and isoform 10. 6 PublicationsAdd BLAST18
Alternative sequenceiVSP_0308891M → MAEGAQPHQPPQLGPGAAAR GMKRESELELPVPGAGGDGA DPGLSKRPRTEEAAADGGGG M in isoform 6 and isoform 8. 2 Publications1
Alternative sequenceiVSP_03089094T → TQ in isoform 2, isoform 8 and isoform 9. 3 Publications1
Alternative sequenceiVSP_007181143 – 160Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_007182261 – 265SLPLV → I in isoform 3, isoform 5, isoform 7 and isoform 9. 4 Publications5
Alternative sequenceiVSP_007183311 – 390VYQDG…RFAPY → DMQPTDMHSLLLQPQPPLLQ PLQPLTVTVMAGCTQPTPTM PLPLPLAMELALWRVYTEVA TADLPPTEVT in isoform 4 and isoform 9. 2 PublicationsAdd BLAST80
Alternative sequenceiVSP_030891323 – 390GGYAA…RFAPY → IESANCFRSNRVDMQPTDMH SLLLQPQPPLLQPLQPLTVT VMAGCTQPTPTMPLPLPLAM ELALWRVYTEVATADLPPTE VT in isoform 7. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072786 mRNA Translation: AAL67150.1
AF229058 mRNA Translation: AAL71905.1
AY960684 mRNA Translation: AAX84843.1
AL009266 mRNA Translation: CAA15842.1
CR456559 mRNA Translation: CAG30445.1
AK055213 mRNA Translation: BAB70875.1
AK291460 mRNA Translation: BAF84149.1
DQ778625 mRNA Translation: ABG77459.1
AL049748 Genomic DNA No translation available.
AL079295 Genomic DNA No translation available.
BC013115 mRNA Translation: AAH13115.1
BC025281 mRNA Translation: AAH25281.1
AM419009 mRNA Translation: CAL91352.1
CCDSiCCDS13921.1 [O43251-9]
CCDS43013.1 [O43251-8]
CCDS46699.1 [O43251-4]
CCDS46700.1 [O43251-10]
CCDS46701.1 [O43251-5]
RefSeqiNP_001026865.1, NM_001031695.2 [O43251-10]
NP_001076045.1, NM_001082576.1 [O43251-5]
NP_001076046.1, NM_001082577.1 [O43251-4]
NP_001076047.1, NM_001082578.1
NP_055124.1, NM_014309.2 [O43251-9]
XP_005261494.1, XM_005261437.1
UniGeneiHs.282998

Genome annotation databases

EnsembliENST00000262829; ENSP00000262829; ENSG00000100320 [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320 [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320 [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320 [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320 [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320 [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564 [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564 [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564 [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564 [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564 [O43251-3]
GeneIDi23543
KEGGihsa:23543
UCSCiuc003aoh.5 human [O43251-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072786 mRNA Translation: AAL67150.1
AF229058 mRNA Translation: AAL71905.1
AY960684 mRNA Translation: AAX84843.1
AL009266 mRNA Translation: CAA15842.1
CR456559 mRNA Translation: CAG30445.1
AK055213 mRNA Translation: BAB70875.1
AK291460 mRNA Translation: BAF84149.1
DQ778625 mRNA Translation: ABG77459.1
AL049748 Genomic DNA No translation available.
AL079295 Genomic DNA No translation available.
BC013115 mRNA Translation: AAH13115.1
BC025281 mRNA Translation: AAH25281.1
AM419009 mRNA Translation: CAL91352.1
CCDSiCCDS13921.1 [O43251-9]
CCDS43013.1 [O43251-8]
CCDS46699.1 [O43251-4]
CCDS46700.1 [O43251-10]
CCDS46701.1 [O43251-5]
RefSeqiNP_001026865.1, NM_001031695.2 [O43251-10]
NP_001076045.1, NM_001082576.1 [O43251-5]
NP_001076046.1, NM_001082577.1 [O43251-4]
NP_001076047.1, NM_001082578.1
NP_055124.1, NM_014309.2 [O43251-9]
XP_005261494.1, XM_005261437.1
UniGeneiHs.282998

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CQ3NMR-A113-202[»]
ProteinModelPortaliO43251
SMRiO43251
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117087, 160 interactors
IntActiO43251, 72 interactors
MINTiO43251
STRINGi9606.ENSP00000413035

PTM databases

iPTMnetiO43251
PhosphoSitePlusiO43251

Polymorphism and mutation databases

BioMutaiRBFOX2

Proteomic databases

EPDiO43251
MaxQBiO43251
PaxDbiO43251
PeptideAtlasiO43251
PRIDEiO43251
ProteomicsDBi48827
48828 [O43251-10]
48829 [O43251-2]
48830 [O43251-3]
48831 [O43251-4]
48832 [O43251-5]
48833 [O43251-6]
48834 [O43251-7]
48835 [O43251-8]
48836 [O43251-9]

Protocols and materials databases

DNASUi23543
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262829; ENSP00000262829; ENSG00000100320 [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320 [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320 [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320 [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320 [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320 [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564 [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564 [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564 [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564 [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564 [O43251-3]
GeneIDi23543
KEGGihsa:23543
UCSCiuc003aoh.5 human [O43251-1]

Organism-specific databases

CTDi23543
DisGeNETi23543
EuPathDBiHostDB:ENSG00000100320.22
GeneCardsiRBFOX2
H-InvDBiHIX0016419
HGNCiHGNC:9906 RBFOX2
HPAiHPA006240
MIMi612149 gene
neXtProtiNX_O43251
OpenTargetsiENSG00000100320
PharmGKBiPA34272
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0125 Eukaryota
ENOG4111WJT LUCA
GeneTreeiENSGT00390000013767
HOVERGENiHBG000044
InParanoidiO43251
KOiK14946
OMAiPARDSQX
OrthoDBiEOG091G15X5
PhylomeDBiO43251
TreeFamiTF315942

Enzyme and pathway databases

ReactomeiR-HSA-6803529 FGFR2 alternative splicing

Miscellaneous databases

ChiTaRSiRBFOX2 human
EvolutionaryTraceiO43251
GeneWikiiRBM9
GenomeRNAii23543
PROiPR:O43251
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100320 Expressed in 240 organ(s), highest expression level in frontal cortex
CleanExiHS_RBM9
ExpressionAtlasiO43251 baseline and differential
GenevisibleiO43251 HS

Family and domain databases

CDDicd12407 RRM_FOX1_like, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR025670 Fox-1_C_dom
IPR034237 FOX1_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR017325 RNA-bd_Fox-1
IPR000504 RRM_dom
PfamiView protein in Pfam
PF12414 Fox-1_C, 1 hit
PF00076 RRM_1, 1 hit
PIRSFiPIRSF037932 Ataxin_2_bd_A2BP, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRFOX2_HUMAN
AccessioniPrimary (citable) accession number: O43251
Secondary accession number(s): A4F5G8
, A8K5Z5, B0QYY8, B0QYY9, Q0PRL5, Q0VH35, Q5TF71, Q6IC09, Q8TD00, Q8WYB1, Q96DZ6, Q96NL7, Q9UGW4, Q9UH33
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: April 11, 2003
Last modified: November 7, 2018
This is version 181 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again