Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O43251 (RFOX2_HUMAN)

Entry version 197 (10 Feb 2021)
Sequence version 3 (11 Apr 2003)
Previous versions | rss
Add a publicationFeedback
Protein

RNA binding protein fox-1 homolog 2

Gene

RBFOX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43251

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6803529, FGFR2 alternative splicing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RNA binding protein fox-1 homolog 2
Alternative name(s):
Fox-1 homolog B
Hexaribonucleotide-binding protein 2
RNA-binding motif protein 9
RNA-binding protein 9
Repressor of tamoxifen transcriptional activity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBFOX2
Synonyms:FOX2, HRNBP2, RBM9, RTA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9906, RBFOX2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612149, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43251

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000100320.22

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		23543

Open Targets

More...OpenTargetsi		ENSG00000100320

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA34272

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43251, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RBFOX2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000817661 – 390RNA binding protein fox-1 homolog 2Add BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei281Omega-N-methylarginineBy similarity1
Modified residuei297Asymmetric dimethylarginineBy similarity1
Modified residuei329Asymmetric dimethylarginineCombined sources1
Modified residuei381Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei381Omega-N-methylarginine; alternateBy similarity1
Modified residuei386Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei386Omega-N-methylarginine; alternateBy similarity1
Isoform 6 (identifier: O43251-6)
Modified residuei67PhosphothreonineCombined sources1
Isoform 8 (identifier: O43251-8)
Modified residuei67PhosphothreonineCombined sources1
Isoform 3 (identifier: O43251-3)
Modified residuei249Omega-N-methylarginineCombined sources1
Isoform 5 (identifier: O43251-5)
Modified residuei267Omega-N-methylarginineCombined sources1
Isoform 9 (identifier: O43251-9)
Modified residuei268Omega-N-methylarginineCombined sources1
Isoform 7 (identifier: O43251-7)
Modified residuei277Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O43251

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43251

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43251

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43251

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43251

PeptideAtlas

More...PeptideAtlasi		O43251

PRoteomics IDEntifications database

More...PRIDEi		O43251

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48827 [O43251-1]
48828 [O43251-10]
48829 [O43251-2]
48830 [O43251-3]
48831 [O43251-4]
48832 [O43251-5]
48833 [O43251-6]
48834 [O43251-7]
48835 [O43251-8]
48836 [O43251-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43251

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43251

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000100320, Expressed in frontal cortex and 248 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43251, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43251, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000100320, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ER-alpha N-terminal activation domain.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei122Interaction with RNABy similarity1
Sitei130Interaction with RNABy similarity1
Sitei131Interaction with RNABy similarity1
Sitei155Interaction with RNABy similarity1
Sitei160Interaction with RNABy similarity1
Sitei164Interaction with RNABy similarity1
Sitei188Interaction with RNABy similarity1
Sitei198Interaction with RNABy similarity1

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
O43251
With#Exp.IntAct
ATXN1 [P54253]10EBI-746056,EBI-930964
BOLL [Q8N9W6]4EBI-746056,EBI-998198
C1orf94 [Q6P1W5]3EBI-746056,EBI-946029
CAMK2B [Q13554]3EBI-746056,EBI-1058722
DAB1 [O75553]3EBI-746056,EBI-7875264
DAZAP2 [Q15038]4EBI-746056,EBI-724310
ESR1 [P03372]4EBI-746056,EBI-78473
HNRNPF [P52597]4EBI-746056,EBI-352986
MAGED1 [Q9Y5V3]3EBI-746056,EBI-716006
MAPK1IP1L [Q8NDC0]3EBI-746056,EBI-741424
NAF1 [Q96HR8]3EBI-746056,EBI-2515597
PSMA3 [P25788]3EBI-746056,EBI-348380
QKI [Q96PU8]3EBI-746056,EBI-945792
RBFOX1 [Q9NWB1]2EBI-746056,EBI-945906
RNF8 [O76064]3EBI-746056,EBI-373337
VAC14 [Q08AM6]4EBI-746056,EBI-2107455
Isoform 3 [O43251-3]
With#Exp.IntAct
HTT [P42858]3EBI-11531589,EBI-466029
Isoform 6 [O43251-6]
With#Exp.IntAct
A0A142I5B9 from Zika virus (isolate ZIKV/Human/Cambodia/FSS13025/2010).3EBI-10987522,EBI-20625235
Isoform 10 [O43251-10]
With#Exp.IntAct
ATXN1 [P54253]3EBI-11963050,EBI-930964
ATXN1L [P0C7T5]3EBI-11963050,EBI-8624731
BOLL - isoform 4 [Q8N9W6-4]3EBI-11963050,EBI-11983447
CAMK2A [Q9UQM7]3EBI-11963050,EBI-1383687
CHERP [Q8IWX8]3EBI-11963050,EBI-2555370
DAZAP2 [Q15038]4EBI-11963050,EBI-724310
FAM168B - isoform 2 [A1KXE4-2]3EBI-11963050,EBI-12193763
HNRNPF [P52597]3EBI-11963050,EBI-352986
HNRNPH1 [P31943]3EBI-11963050,EBI-351590
KRTAP6-2 [Q3LI66]3EBI-11963050,EBI-11962084
MAGED1 [Q9Y5V3]3EBI-11963050,EBI-716006
OXER1 [Q8TDS5]3EBI-11963050,EBI-12813389
PCBP1 [Q15365]3EBI-11963050,EBI-946095
RBPMS - isoform C [Q93062-3]3EBI-11963050,EBI-740343
RBPMS2 [Q6ZRY4]5EBI-11963050,EBI-11987469
RHOXF2 [Q9BQY4]3EBI-11963050,EBI-372094
RNF8 [O76064]3EBI-11963050,EBI-373337
TEX37 [Q96LM6]3EBI-11963050,EBI-743976
UBQLN2 [Q9UHD9]3EBI-11963050,EBI-947187

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117087, 186 interactors

Protein interaction database and analysis system

More...IntActi		O43251, 111 interactors

Molecular INTeraction database

More...MINTi		O43251

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000413035

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43251, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1390
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43251

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O43251

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini121 – 197RRMPROSITE-ProRule annotationAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi273 – 377Ala-richAdd BLAST105

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0125, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157534

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43251

Identification of Orthologs from Complete Genome Data

More...OMAi		QTHGEQN

Database of Orthologous Groups

More...OrthoDBi		871288at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43251

TreeFam database of animal gene trees

More...TreeFami		TF315942

Family and domain databases

Conserved Domains Database

More...CDDi		cd12407, RRM_FOX1_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025670, Fox-1_C_dom
IPR034237, FOX1_RRM
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR017325, RNA-bd_Fox-1
IPR000504, RRM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12414, Fox-1_C, 1 hit
PF00076, RRM_1, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037932, Ataxin_2_bd_A2BP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360, RRM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928, SSF54928, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50102, RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43251-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQNEPLTPGY HGFPARDSQG NQEPTTTPDA MVQPFTTIPF PPPPQNGIPT 
        60         70         80         90        100
EYGVPHTQDY AGQTGEHNLT LYGSTQAHGE QSSNSPSTQN GSLTTEGGAQ 
       110        120        130        140        150
TDGQQSQTQS SENSESKSTP KRLHVSNIPF RFRDPDLRQM FGQFGKILDV 
       160        170        180        190        200
EIIFNERGSK GFGFVTFENS ADADRAREKL HGTVVEGRKI EVNNATARVM 
       210        220        230        240        250
TNKKMVTPYA NGWKLSPVVG AVYGPELYAA SSFQADVSLG NDAAVPLSGR 
       260        270        280        290        300
GGINTYIPLI SLPLVPGFPY PTAATTAAAF RGAHLRGRGR TVYGAVRAVP 
       310        320        330        340        350
PTAIPAYPGV VYQDGFYGAD LYGGYAAYRY AQPATATAAT AAAAAAAAYS 
       360        370        380        390
DGYGRVYTAD PYHALAPAAS YGVGAVASLY RGGYSRFAPY
Length:390
Mass (Da):41,374
Last modified:April 11, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i40D6C8C40764B317
GO
Isoform 2 (identifier: O43251-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ

Show »
Length:381
Mass (Da):40,479
Checksum:i553FE52BD48F7062
GO
Isoform 3 (identifier: O43251-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     143-160: Missing.
     261-265: SLPLV → I

Show »
Length:358
Mass (Da):37,879
Checksum:iBA4B3740D2DA6E7A
GO
Isoform 4 (identifier: O43251-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Show »
Length:370
Mass (Da):39,783
Checksum:i725D8B1C719AEB10
GO
Isoform 5 (identifier: O43251-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     261-265: SLPLV → I

Show »
Length:376
Mass (Da):39,954
Checksum:iA50D5086B4436165
GO
Isoform 6 (identifier: O43251-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM

Show »
Length:450
Mass (Da):47,215
Checksum:i56D559291EF61ECF
GO
Isoform 7 (identifier: O43251-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-265: SLPLV → I
     323-390: GGYAAYRYAQ...RGGYSRFAPY → IESANCFRSN...TADLPPTEVT

Show »
Length:400
Mass (Da):43,179
Checksum:i6A4D8B3E2FAA5726
GO
Isoform 8 (identifier: O43251-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEGAQPHQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGM
     94-94: T → TQ

Show »
Length:451
Mass (Da):47,343
Checksum:iF4E92F3CCC76447B
GO
Isoform 9 (identifier: O43251-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT
     94-94: T → TQ
     261-265: SLPLV → I
     311-390: VYQDGFYGAD...RGGYSRFAPY → DMQPTDMHSL...TADLPPTEVT

Show »
Length:367
Mass (Da):39,515
Checksum:i7A2C1824C39B7FA4
GO
Isoform 10 (identifier: O43251-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MQNEPLTPGYHGFPARDS → MEKKKMVT

Show »
Length:380
Mass (Da):40,351
Checksum:i601F4E31E7C20715
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B0QYY4B0QYY4_HUMAN
RNA binding protein fox-1 homolog 2
RBFOX2
370Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYV1B0QYV1_HUMAN
RNA binding protein fox-1 homolog 2
RBFOX2
357Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYY7B0QYY7_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
200Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R469S4R469_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
234Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRA5A0A0G2JRA5_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
389Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYY6B0QYY6_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
128Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JSB3A0A0G2JSB3_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3K7S4R3K7_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
230Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRD1A0A0G2JRD1_HUMAN
RNA-binding protein fox-1 homolog 2
RBFOX2
227Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti116S → G in AAX84843 (PubMed:14702039).Curated1
Sequence conflicti231S → F in BAB70875 (PubMed:12529303).Curated1
Sequence conflicti346A → V in AAH13115 (PubMed:15489334).Curated1
Sequence conflicti350S → G in BAB70875 (PubMed:12529303).Curated1
Isoform 6 (identifier: O43251-6)
Sequence conflicti8H → Q in BAB70875 (PubMed:12529303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0071801 – 18MQNEP…PARDS → MEKKKMVT in isoform 2, isoform 3, isoform 4, isoform 5, isoform 9 and isoform 10. 6 PublicationsAdd BLAST18
Alternative sequenceiVSP_0308891M → MAEGAQPHQPPQLGPGAAAR GMKRESELELPVPGAGGDGA DPGLSKRPRTEEAAADGGGG M in isoform 6 and isoform 8. 2 Publications1
Alternative sequenceiVSP_03089094T → TQ in isoform 2, isoform 8 and isoform 9. 3 Publications1
Alternative sequenceiVSP_007181143 – 160Missing in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_007182261 – 265SLPLV → I in isoform 3, isoform 5, isoform 7 and isoform 9. 4 Publications5
Alternative sequenceiVSP_007183311 – 390VYQDG…RFAPY → DMQPTDMHSLLLQPQPPLLQ PLQPLTVTVMAGCTQPTPTM PLPLPLAMELALWRVYTEVA TADLPPTEVT in isoform 4 and isoform 9. 2 PublicationsAdd BLAST80
Alternative sequenceiVSP_030891323 – 390GGYAA…RFAPY → IESANCFRSNRVDMQPTDMH SLLLQPQPPLLQPLQPLTVT VMAGCTQPTPTMPLPLPLAM ELALWRVYTEVATADLPPTE VT in isoform 7. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY072786 mRNA Translation: AAL67150.1
AF229058 mRNA Translation: AAL71905.1
AY960684 mRNA Translation: AAX84843.1
AL009266 mRNA Translation: CAA15842.1
CR456559 mRNA Translation: CAG30445.1
AK055213 mRNA Translation: BAB70875.1
AK291460 mRNA Translation: BAF84149.1
DQ778625 mRNA Translation: ABG77459.1
AL049748 Genomic DNA No translation available.
AL079295 Genomic DNA No translation available.
BC013115 mRNA Translation: AAH13115.1
BC025281 mRNA Translation: AAH25281.1
AM419009 mRNA Translation: CAL91352.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13921.1 [O43251-9]
CCDS43013.1 [O43251-8]
CCDS46699.1 [O43251-4]
CCDS46700.1 [O43251-10]
CCDS46701.1 [O43251-5]

NCBI Reference Sequences

More...RefSeqi		NP_001026865.1, NM_001031695.2 [O43251-10]
NP_001076045.1, NM_001082576.1 [O43251-5]
NP_001076046.1, NM_001082577.1 [O43251-4]
NP_001076047.1, NM_001082578.1 [O43251-8]
NP_055124.1, NM_014309.2 [O43251-9]
XP_005261494.1, XM_005261437.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000262829; ENSP00000262829; ENSG00000100320 [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320 [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320 [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320 [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320 [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320 [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564 [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564 [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564 [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564 [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564 [O43251-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23543

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23543

UCSC genome browser

More...UCSCi		uc003aoh.5, human [O43251-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY072786 mRNA Translation: AAL67150.1
AF229058 mRNA Translation: AAL71905.1
AY960684 mRNA Translation: AAX84843.1
AL009266 mRNA Translation: CAA15842.1
CR456559 mRNA Translation: CAG30445.1
AK055213 mRNA Translation: BAB70875.1
AK291460 mRNA Translation: BAF84149.1
DQ778625 mRNA Translation: ABG77459.1
AL049748 Genomic DNA No translation available.
AL079295 Genomic DNA No translation available.
BC013115 mRNA Translation: AAH13115.1
BC025281 mRNA Translation: AAH25281.1
AM419009 mRNA Translation: CAL91352.1
CCDSiCCDS13921.1 [O43251-9]
CCDS43013.1 [O43251-8]
CCDS46699.1 [O43251-4]
CCDS46700.1 [O43251-10]
CCDS46701.1 [O43251-5]
RefSeqiNP_001026865.1, NM_001031695.2 [O43251-10]
NP_001076045.1, NM_001082576.1 [O43251-5]
NP_001076046.1, NM_001082577.1 [O43251-4]
NP_001076047.1, NM_001082578.1 [O43251-8]
NP_055124.1, NM_014309.2 [O43251-9]
XP_005261494.1, XM_005261437.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CQ3NMR-A113-202[»]
SMRiO43251
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117087, 186 interactors
IntActiO43251, 111 interactors
MINTiO43251
STRINGi9606.ENSP00000413035

PTM databases

iPTMnetiO43251
PhosphoSitePlusiO43251

Genetic variation databases

BioMutaiRBFOX2

Proteomic databases

EPDiO43251
jPOSTiO43251
MassIVEiO43251
MaxQBiO43251
PaxDbiO43251
PeptideAtlasiO43251
PRIDEiO43251
ProteomicsDBi48827 [O43251-1]
48828 [O43251-10]
48829 [O43251-2]
48830 [O43251-3]
48831 [O43251-4]
48832 [O43251-5]
48833 [O43251-6]
48834 [O43251-7]
48835 [O43251-8]
48836 [O43251-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		331, 235 antibodies

The DNASU plasmid repository

More...DNASUi		23543

Genome annotation databases

EnsembliENST00000262829; ENSP00000262829; ENSG00000100320 [O43251-3]
ENST00000405409; ENSP00000384944; ENSG00000100320 [O43251-9]
ENST00000414461; ENSP00000407855; ENSG00000100320 [O43251-4]
ENST00000416721; ENSP00000405651; ENSG00000100320 [O43251-5]
ENST00000438146; ENSP00000413035; ENSG00000100320 [O43251-8]
ENST00000449924; ENSP00000391670; ENSG00000100320 [O43251-10]
ENST00000618140; ENSP00000482053; ENSG00000277564 [O43251-9]
ENST00000619768; ENSP00000479761; ENSG00000277564 [O43251-10]
ENST00000626107; ENSP00000485984; ENSG00000277564 [O43251-4]
ENST00000627946; ENSP00000487477; ENSG00000277564 [O43251-5]
ENST00000631365; ENSP00000485711; ENSG00000277564 [O43251-3]
GeneIDi23543
KEGGihsa:23543
UCSCiuc003aoh.5, human [O43251-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23543
DisGeNETi23543

GeneCards: human genes, protein and diseases

More...GeneCardsi		RBFOX2
HGNCiHGNC:9906, RBFOX2
HPAiENSG00000100320, Low tissue specificity
MIMi612149, gene
neXtProtiNX_O43251
OpenTargetsiENSG00000100320
PharmGKBiPA34272
VEuPathDBiHostDB:ENSG00000100320.22

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0125, Eukaryota
GeneTreeiENSGT00940000157534
InParanoidiO43251
OMAiQTHGEQN
OrthoDBi871288at2759
PhylomeDBiO43251
TreeFamiTF315942

Enzyme and pathway databases

PathwayCommonsiO43251
ReactomeiR-HSA-6803529, FGFR2 alternative splicing

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23543, 9 hits in 877 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RBFOX2, human
EvolutionaryTraceiO43251

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RBM9

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23543
PharosiO43251, Tbio

Protein Ontology

More...PROi		PR:O43251
RNActiO43251, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000100320, Expressed in frontal cortex and 248 other tissues
ExpressionAtlasiO43251, baseline and differential
GenevisibleiO43251, HS

Family and domain databases

CDDicd12407, RRM_FOX1_like, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR025670, Fox-1_C_dom
IPR034237, FOX1_RRM
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR017325, RNA-bd_Fox-1
IPR000504, RRM_dom
PfamiView protein in Pfam
PF12414, Fox-1_C, 1 hit
PF00076, RRM_1, 1 hit
PIRSFiPIRSF037932, Ataxin_2_bd_A2BP, 1 hit
SMARTiView protein in SMART
SM00360, RRM, 1 hit
SUPFAMiSSF54928, SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102, RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRFOX2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43251
Secondary accession number(s): A4F5G8
, A8K5Z5, B0QYY8, B0QYY9, Q0PRL5, Q0VH35, Q5TF71, Q6IC09, Q8TD00, Q8WYB1, Q96DZ6, Q96NL7, Q9UGW4, Q9UH33
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: April 11, 2003
Last modified: February 10, 2021
This is version 197 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again