Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (17 Jun 2020)
Sequence version 1 (01 Jun 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Septin-4

Gene

SEPTIN4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (PubMed:25588830). May play a role in platelet secretion. Isoform ARTS, but not the other isoforms, is required for the induction of cell death mediated by TGF-beta and by other apoptotic stimuli.By similarityCurated5 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei185GTPBy similarity1
Binding sitei211GTP; via amide nitrogenBy similarity1
Binding sitei348GTP; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei363GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi151 – 158GTPBy similarity8
Nucleotide bindingi290 – 298GTPBy similarity9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Differentiation, Spermatogenesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111457 Release of apoptotic factors from the mitochondria [O43236-6]
R-HSA-111469 SMAC, XIAP-regulated apoptotic response [O43236-6]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Septin-4
Alternative name(s):
Apoptosis-related protein in the TGF-beta signaling pathway
Short name:
ARTS
Bradeion beta
Brain protein H5
CE5B3 beta
Cell division control-related protein 2
Short name:
hCDCREL-2
Cerebral protein 7
Peanut-like protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEPTIN4Imported
Synonyms:ARTS, PNUTL2, SEP4, SEPT4
ORF Names:hucep-7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000108387.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9165 SEPTIN4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603696 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43236

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum, Mitochondrion, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi156 – 158GKS → ENP: Loss of TGF-beta-induced apoptosis. No translocation to the nucleus following TGF-beta treatment. Loss of XIAP-binding. 1 Publication3

Organism-specific databases

DisGeNET

More...
DisGeNETi
5414

Open Targets

More...
OpenTargetsi
ENSG00000108387

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33487

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O43236 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEPT4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001735191 – 478Septin-4Add BLAST478

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei117PhosphoserineCombined sources1
Modified residuei118PhosphoserineCombined sources1
Modified residuei325PhosphoserineCombined sources1
Modified residuei432PhosphoserineBy similarity1
Modified residuei434PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43236

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O43236

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43236

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43236

PeptideAtlas

More...
PeptideAtlasi
O43236

PRoteomics IDEntifications database

More...
PRIDEi
O43236

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
48814 [O43236-1]
48815 [O43236-2]
48816 [O43236-3]
48817 [O43236-4]
48818 [O43236-5]
48819 [O43236-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43236

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43236

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in adult and fetal tissues with highest expression in adult brain (at protein level), heart, liver and adrenal gland and fetal heart, kidney, liver and lung. Also expressed in colorectal cancers and malignant melanomas. Expressed in platelets.6 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108387 Expressed in corpus callosum and 179 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43236 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43236 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000108387 Tissue enhanced (adrenal gland, brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity).

Interacts with SEPTIN8. In a mesenchymal cell line, interacts with SEPTIN9 isoform 2 variants HNA Trp-106 and Phe-111, but not the wild type SEPTIN9.

Component of a septin core octomeric complex consisting of SEPTIN12, SEPTIN7, SEPTIN6 and SEPTIN2 or SEPTIN4 in the order 12-7-6-2-2-6-7-12 or 12-7-6-4-4-6-7-12 and located in the sperm annulus. Isoform ARTS, but no other isoforms, interacts with XIAP after the induction of apoptosis.

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
111415, 20 interactors

Protein interaction database and analysis system

More...
IntActi
O43236, 17 interactors

Molecular INTeraction database

More...
MINTi
O43236

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000402000

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O43236 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43236

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini141 – 414Septin-type GPROSITE-ProRule annotationAdd BLAST274

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni151 – 158G1 motifPROSITE-ProRule annotation8
Regioni208 – 211G3 motifPROSITE-ProRule annotation4
Regioni289 – 292G4 motifPROSITE-ProRule annotation4

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili447 – 478Sequence analysisAdd BLAST32

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2655 Eukaryota
COG5019 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018146

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_017718_7_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43236

Identification of Orthologs from Complete Genome Data

More...
OMAi
EVENIMQ

Database of Orthologous Groups

More...
OrthoDBi
845354at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43236

TreeFam database of animal gene trees

More...
TreeFami
TF101079

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01850 CDC_Septin, 1 hit

Database of protein disorder

More...
DisProti
DP00537
DP01325 [O43236-6]

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
IPR030643 Septin4

The PANTHER Classification System

More...
PANTHERi
PTHR18884:SF71 PTHR18884:SF71, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00735 Septin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF006698 Septin, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51719 G_SEPTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O43236-1) [UniParc]FASTAAdd to basket
Also known as: PNUTL2, PNUTL2a, H5/CDCrel2, SEPT4_i1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSLGWQGN SVPEDRTEAG IKRFLEDTTD DGELSKFVKD FSGNASCHPP
60 70 80 90 100
EAKTWASRPQ VPEPRPQAPD LYDDDLEFRP PSRPQSSDNQ QYFCAPAPLS
110 120 130 140 150
PSARPRSPWG KLDPYDSSED DKEYVGFATL PNQVHRKSVK KGFDFTLMVA
160 170 180 190 200
GESGLGKSTL VNSLFLTDLY RDRKLLGAEE RIMQTVEITK HAVDIEEKGV
210 220 230 240 250
RLRLTIVDTP GFGDAVNNTE CWKPVAEYID QQFEQYFRDE SGLNRKNIQD
260 270 280 290 300
NRVHCCLYFI SPFGHGLRPL DVEFMKALHQ RVNIVPILAK ADTLTPPEVD
310 320 330 340 350
HKKRKIREEI EHFGIKIYQF PDCDSDEDED FKLQDQALKE SIPFAVIGSN
360 370 380 390 400
TVVEARGRRV RGRLYPWGIV EVENPGHCDF VKLRTMLVRT HMQDLKDVTR
410 420 430 440 450
ETHYENYRAQ CIQSMTRLVV KERNRNKLTR ESGTDFPIPA VPPGTDPETE
460 470
KLIREKDEEL RRMQEMLHKI QKQMKENY
Length:478
Mass (Da):55,098
Last modified:June 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2F08D3611EF6523D
GO
Isoform 2 (identifier: O43236-2) [UniParc]FASTAAdd to basket
Also known as: PNUTL2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → M

Show »
Length:459
Mass (Da):53,042
Checksum:iC0779A770DC7415A
GO
Isoform 3 (identifier: O43236-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → MPGFYSVMTDEE

Show »
Length:470
Mass (Da):54,298
Checksum:iBDBB6EB9570D9913
GO
Isoform 4 (identifier: O43236-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → MRSSPALFSSRAAPQKPRKEGSQAAGLLVFSDSLE

Show »
Length:493
Mass (Da):56,613
Checksum:iD015198B93C0ED49
GO
Isoform 5 (identifier: O43236-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-147: Missing.

Show »
Length:331
Mass (Da):38,542
Checksum:iA860BD705573901C
GO
Isoform ARTS (identifier: O43236-6) [UniParc]FASTAAdd to basket
Also known as: SEPT4_i2

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDRSLGWQGNSVPEDRTEAG → M
     267-293: LRPLDVEFMKALHQRVNIVPILAKADT → YGPSLRLLAPPGAVKGTGQEHQGQGCH
     294-478: Missing.

Note: May be defective in GTP-binding.Curated
Show »
Length:274
Mass (Da):30,809
Checksum:i7FA8D55492E9348F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KSZ7J3KSZ7_HUMAN
Septin-4
SEPTIN4
379Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZHH3A0A5F9ZHH3_HUMAN
Septin-4
SEPTIN4
996Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLR2J3QLR2_HUMAN
Septin-4
SEPTIN4
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLA8J3QLA8_HUMAN
Septin-4
SEPTIN4
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZHS9A0A5F9ZHS9_HUMAN
Septin-4
SEPTIN4
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRT6J3QRT6_HUMAN
Septin-4
SEPTIN4
332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRU3J3QRU3_HUMAN
Septin-4
SEPTIN4
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS26J3KS26_HUMAN
Septin-4
SEPTIN4
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS85J3KS85_HUMAN
Septin-4
SEPTIN4
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRS4J3QRS4_HUMAN
Septin-4
SEPTIN4
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti156G → D in BAG37789 (Ref. 7) Curated1
Sequence conflicti382K → E in BAG63517 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051935311E → V. Corresponds to variant dbSNP:rs17741424Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0383021 – 147Missing in isoform 5. 1 PublicationAdd BLAST147
Alternative sequenceiVSP_0060501 – 20MDRSL…RTEAG → M in isoform 2 and isoform ARTS. 4 PublicationsAdd BLAST20
Alternative sequenceiVSP_0383031 – 20MDRSL…RTEAG → MPGFYSVMTDEE in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0383041 – 20MDRSL…RTEAG → MRSSPALFSSRAAPQKPRKE GSQAAGLLVFSDSLE in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_038305267 – 293LRPLD…AKADT → YGPSLRLLAPPGAVKGTGQE HQGQGCH in isoform ARTS. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_038306294 – 478Missing in isoform ARTS. 1 PublicationAdd BLAST185

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF073312 mRNA Translation: AAC25673.1
U88829 mRNA Translation: AAD00653.1
U88870 mRNA Translation: AAD00657.1
AF176379 mRNA Translation: AAG45673.1
AB008753 mRNA Translation: BAB70695.1
D89278 mRNA Translation: BAB46922.1
AF035811 mRNA Translation: AAB88512.1
CR457111 mRNA Translation: CAG33392.1
AK315396 mRNA Translation: BAG37789.1
AK094579 mRNA Translation: BAG52891.1
AK294094 mRNA Translation: BAG57432.1
AK301914 mRNA Translation: BAG63338.1
AK302146 mRNA Translation: BAG63517.1
CH471109 Genomic DNA Translation: EAW94440.1
CH471109 Genomic DNA Translation: EAW94442.1
BC018056 mRNA Translation: AAH18056.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11609.1 [O43236-2]
CCDS11610.1 [O43236-1]
CCDS45743.1 [O43236-6]
CCDS56041.1 [O43236-3]
CCDS58581.1 [O43236-5]
CCDS58582.1 [O43236-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001185642.1, NM_001198713.1 [O43236-3]
NP_001243711.1, NM_001256782.1 [O43236-4]
NP_001243751.1, NM_001256822.1 [O43236-5]
NP_004565.1, NM_004574.4 [O43236-1]
NP_536340.1, NM_080415.3 [O43236-6]
NP_536341.1, NM_080416.3 [O43236-2]
XP_006722017.1, XM_006721954.2 [O43236-5]
XP_006722018.1, XM_006721955.2 [O43236-5]
XP_011523213.1, XM_011524911.1 [O43236-5]
XP_011523214.1, XM_011524912.1 [O43236-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317256; ENSP00000321071; ENSG00000108387 [O43236-2]
ENST00000317268; ENSP00000321674; ENSG00000108387 [O43236-1]
ENST00000393086; ENSP00000376801; ENSG00000108387 [O43236-2]
ENST00000412945; ENSP00000414779; ENSG00000108387 [O43236-3]
ENST00000426861; ENSP00000402348; ENSG00000108387 [O43236-6]
ENST00000457347; ENSP00000402000; ENSG00000108387 [O43236-4]
ENST00000583114; ENSP00000463768; ENSG00000108387 [O43236-5]
ENST00000672699; ENSP00000500355; ENSG00000108387 [O43236-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5414

UCSC genome browser

More...
UCSCi
uc002iwm.4 human [O43236-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF073312 mRNA Translation: AAC25673.1
U88829 mRNA Translation: AAD00653.1
U88870 mRNA Translation: AAD00657.1
AF176379 mRNA Translation: AAG45673.1
AB008753 mRNA Translation: BAB70695.1
D89278 mRNA Translation: BAB46922.1
AF035811 mRNA Translation: AAB88512.1
CR457111 mRNA Translation: CAG33392.1
AK315396 mRNA Translation: BAG37789.1
AK094579 mRNA Translation: BAG52891.1
AK294094 mRNA Translation: BAG57432.1
AK301914 mRNA Translation: BAG63338.1
AK302146 mRNA Translation: BAG63517.1
CH471109 Genomic DNA Translation: EAW94440.1
CH471109 Genomic DNA Translation: EAW94442.1
BC018056 mRNA Translation: AAH18056.3
CCDSiCCDS11609.1 [O43236-2]
CCDS11610.1 [O43236-1]
CCDS45743.1 [O43236-6]
CCDS56041.1 [O43236-3]
CCDS58581.1 [O43236-5]
CCDS58582.1 [O43236-4]
RefSeqiNP_001185642.1, NM_001198713.1 [O43236-3]
NP_001243711.1, NM_001256782.1 [O43236-4]
NP_001243751.1, NM_001256822.1 [O43236-5]
NP_004565.1, NM_004574.4 [O43236-1]
NP_536340.1, NM_080415.3 [O43236-6]
NP_536341.1, NM_080416.3 [O43236-2]
XP_006722017.1, XM_006721954.2 [O43236-5]
XP_006722018.1, XM_006721955.2 [O43236-5]
XP_011523213.1, XM_011524911.1 [O43236-5]
XP_011523214.1, XM_011524912.1 [O43236-5]

3D structure databases

SMRiO43236
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi111415, 20 interactors
IntActiO43236, 17 interactors
MINTiO43236
STRINGi9606.ENSP00000402000

PTM databases

iPTMnetiO43236
PhosphoSitePlusiO43236

Polymorphism and mutation databases

BioMutaiSEPT4

Proteomic databases

jPOSTiO43236
MassIVEiO43236
MaxQBiO43236
PaxDbiO43236
PeptideAtlasiO43236
PRIDEiO43236
ProteomicsDBi48814 [O43236-1]
48815 [O43236-2]
48816 [O43236-3]
48817 [O43236-4]
48818 [O43236-5]
48819 [O43236-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3484 250 antibodies

The DNASU plasmid repository

More...
DNASUi
5414

Genome annotation databases

EnsembliENST00000317256; ENSP00000321071; ENSG00000108387 [O43236-2]
ENST00000317268; ENSP00000321674; ENSG00000108387 [O43236-1]
ENST00000393086; ENSP00000376801; ENSG00000108387 [O43236-2]
ENST00000412945; ENSP00000414779; ENSG00000108387 [O43236-3]
ENST00000426861; ENSP00000402348; ENSG00000108387 [O43236-6]
ENST00000457347; ENSP00000402000; ENSG00000108387 [O43236-4]
ENST00000583114; ENSP00000463768; ENSG00000108387 [O43236-5]
ENST00000672699; ENSP00000500355; ENSG00000108387 [O43236-4]
GeneIDi5414
UCSCiuc002iwm.4 human [O43236-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5414
DisGeNETi5414
EuPathDBiHostDB:ENSG00000108387.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEPTIN4
HGNCiHGNC:9165 SEPTIN4
HPAiENSG00000108387 Tissue enhanced (adrenal gland, brain)
MIMi603696 gene
neXtProtiNX_O43236
OpenTargetsiENSG00000108387
PharmGKBiPA33487

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2655 Eukaryota
COG5019 LUCA
GeneTreeiENSGT00390000018146
HOGENOMiCLU_017718_7_0_1
InParanoidiO43236
OMAiEVENIMQ
OrthoDBi845354at2759
PhylomeDBiO43236
TreeFamiTF101079

Enzyme and pathway databases

ReactomeiR-HSA-111457 Release of apoptotic factors from the mitochondria [O43236-6]
R-HSA-111469 SMAC, XIAP-regulated apoptotic response [O43236-6]

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
5414 1 hit in 767 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SEPT4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SEPT4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5414
PharosiO43236 Tbio

Protein Ontology

More...
PROi
PR:O43236
RNActiO43236 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108387 Expressed in corpus callosum and 179 other tissues
ExpressionAtlasiO43236 baseline and differential
GenevisibleiO43236 HS

Family and domain databases

CDDicd01850 CDC_Septin, 1 hit
DisProtiDP00537
DP01325 [O43236-6]
InterProiView protein in InterPro
IPR030379 G_SEPTIN_dom
IPR027417 P-loop_NTPase
IPR016491 Septin
IPR030643 Septin4
PANTHERiPTHR18884:SF71 PTHR18884:SF71, 1 hit
PfamiView protein in Pfam
PF00735 Septin, 1 hit
PIRSFiPIRSF006698 Septin, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51719 G_SEPTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEPT4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43236
Secondary accession number(s): B2RD42
, B3KSX9, B4DXC6, B4DXV5, Q6IAP3, Q9H315, Q9UM58
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: June 1, 1998
Last modified: June 17, 2020
This is version 182 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again