Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O43184 (ADA12_HUMAN)

Entry version 205 (25 May 2022)
Sequence version 3 (05 May 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Disintegrin and metalloproteinase domain-containing protein 12

Gene

ADAM12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors (By similarity).

By similarity

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+Note: Binds 1 zinc ion per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi179Zinc; in inhibited formBy similarity1
Metal bindingi350Zinc; catalytic1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3511
Metal bindingi354Zinc; catalytic1
Metal bindingi360Zinc; catalytic1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processCell adhesion
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.24.B10, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O43184

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-177929, Signaling by EGFR
R-HSA-8941237, Invadopodia formation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O43184

SIGNOR Signaling Network Open Resource

More...SIGNORi		O43184

Protein family/group databases

MEROPS protease database

More...MEROPSi		M12.212

Transport Classification Database

More...TCDBi		8.A.77.1.5, the sheddase (sheddase) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 12 (EC:3.4.24.-)
Short name:
ADAM 12
Alternative name(s):
Meltrin-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAM12
Synonyms:MLTN
ORF Names:UNQ346/PRO545
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:190, ADAM12

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602714, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O43184

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000148848

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini208 – 708ExtracellularSequence analysisAdd BLAST501
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei709 – 729HelicalSequence analysisAdd BLAST21
Topological domaini730 – 909CytoplasmicSequence analysisAdd BLAST180

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8038

Open Targets

More...OpenTargetsi		ENSG00000148848

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24507

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O43184, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5030

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1660

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADAM12

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002907829 – 207By similarityAdd BLAST179
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029079208 – 909Disintegrin and metalloproteinase domain-containing protein 12Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi111N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi149N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi325 ↔ 411By similarity
Disulfide bondi367 ↔ 395By similarity
Disulfide bondi369 ↔ 378By similarity
Glycosylationi381N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi452N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi482 ↔ 502By similarity
Glycosylationi651N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi660 ↔ 670By similarity
Disulfide bondi664 ↔ 676By similarity
Disulfide bondi678 ↔ 687By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei907Phosphotyrosine; by SRCBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein, Zymogen

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O43184

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O43184

MaxQB - The MaxQuant DataBase

More...MaxQBi		O43184

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O43184

PeptideAtlas

More...PeptideAtlasi		O43184

PRoteomics IDEntifications database

More...PRIDEi		O43184

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48799 [O43184-1]
48800 [O43184-2]
48801 [O43184-3]
48802 [O43184-4]

PTM databases

CarbonylDB database of protein carbonylation sites

More...CarbonylDBi		O43184

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O43184, 5 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O43184

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O43184

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in placenta and skeletal, cardiac, and smooth muscle. Isoform 2 seems to be expressed only in placenta or in embryo and fetus. Both forms were expressed in some tumor cells lines. Not detected in brain, lung, liver, kidney or pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000148848, Expressed in placenta and 176 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O43184, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O43184, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000148848, Tissue enriched (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with alpha-actinin-2 and with syndecans (By similarity).

Interacts with SH3PXD2A.

Interacts with FST3.

Interacts with RACK1; the interaction is required for PKC-dependent translocation of ADAM12 to the cell membrane.

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113731, 39 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O43184

Protein interaction database and analysis system

More...IntActi		O43184, 46 interactors

Molecular INTeraction database

More...MINTi		O43184

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000357668

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		O43184

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O43184, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		O43184

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O43184

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini214 – 416Peptidase M12BPROSITE-ProRule annotationAdd BLAST203
Domaini424 – 510DisintegrinPROSITE-ProRule annotationAdd BLAST87
Domaini656 – 688EGF-likePROSITE-ProRule annotationAdd BLAST33

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni822 – 862DisorderedSequence analysisAdd BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi177 – 184Cysteine switchBy similarity8
Motifi828 – 834SH3-binding; class IIBy similarity7
Motifi834 – 841SH3-binding; class IBy similarity8
Motifi885 – 891SH3-binding; class IBy similarity7

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cysteine-rich domain supports cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. In carcinomas cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading.
The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Keywords - Domaini

EGF-like domain, SH3-binding, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3607, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155495

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012714_7_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O43184

Identification of Orthologs from Complete Genome Data

More...OMAi		SYMLEPC

Database of Orthologous Groups

More...OrthoDBi		162519at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O43184

TreeFam database of animal gene trees

More...TreeFami		TF314733

Family and domain databases

Conserved Domains Database

More...CDDi		cd04269, ZnMc_adamalysin_II_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.390.10, 1 hit
4.10.70.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006586, ADAM_Cys-rich
IPR018358, Disintegrin_CS
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00289, DISINTEGRIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57552, SSF57552, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS00427, DISINTEGRIN_1, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS50026, EGF_3, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O43184-1) [UniParc]FASTAAdd to basket
Also known as: 12L

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARPLPVSP ARALLLALAG ALLAPCEARG VSLWNQGRAD EVVSASVGSG 
        60         70         80         90        100
DLWIPVKSFD SKNHPEVLNI RLQRESKELI INLERNEGLI ASSFTETHYL 
       110        120        130        140        150
QDGTDVSLAR NYTVILGHCY YHGHVRGYSD SAVSLSTCSG LRGLIVFENE 
       160        170        180        190        200
SYVLEPMKSA TNRYKLFPAK KLKSVRGSCG SHHNTPNLAA KNVFPPPSQT 
       210        220        230        240        250
WARRHKRETL KATKYVELVI VADNREFQRQ GKDLEKVKQR LIEIANHVDK 
       260        270        280        290        300
FYRPLNIRIV LVGVEVWNDM DKCSVSQDPF TSLHEFLDWR KMKLLPRKSH 
       310        320        330        340        350
DNAQLVSGVY FQGTTIGMAP IMSMCTADQS GGIVMDHSDN PLGAAVTLAH 
       360        370        380        390        400
ELGHNFGMNH DTLDRGCSCQ MAVEKGGCIM NASTGYPFPM VFSSCSRKDL 
       410        420        430        440        450
ETSLEKGMGV CLFNLPEVRE SFGGQKCGNR FVEEGEECDC GEPEECMNRC 
       460        470        480        490        500
CNATTCTLKP DAVCAHGLCC EDCQLKPAGT ACRDSSNSCD LPEFCTGASP 
       510        520        530        540        550
HCPANVYLHD GHSCQDVDGY CYNGICQTHE QQCVTLWGPG AKPAPGICFE 
       560        570        580        590        600
RVNSAGDPYG NCGKVSKSSF AKCEMRDAKC GKIQCQGGAS RPVIGTNAVS 
       610        620        630        640        650
IETNIPLQQG GRILCRGTHV YLGDDMPDPG LVLAGTKCAD GKICLNRQCQ 
       660        670        680        690        700
NISVFGVHEC AMQCHGRGVC NNRKNCHCEA HWAPPFCDKF GFGGSTDSGP 
       710        720        730        740        750
IRQADNQGLT IGILVTILCL LAAGFVVYLK RKTLIRLLFT NKKTTIEKLR 
       760        770        780        790        800
CVRPSRPPRG FQPCQAHLGH LGKGLMRKPP DSYPPKDNPR RLLQCQNVDI 
       810        820        830        840        850
SRPLNGLNVP QPQSTQRVLP PLHRAPRAPS VPARPLPAKP ALRQAQGTCK 
       860        870        880        890        900
PNPPQKPLPA DPLARTTRLT HALARTPGQW ETGLRLAPLR PAPQYPHQVP 

RSTHTAYIK
Length:909
Mass (Da):99,542
Last modified:May 5, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE28131C64C4304AB
GO
Isoform 2 (identifier: O43184-2) [UniParc]FASTAAdd to basket
Also known as: 12S

The sequence of this isoform differs from the canonical sequence as follows:
     705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI
     739-909: Missing.

Show »
Length:738
Mass (Da):80,403
Checksum:i19699D2852ED28F6
GO
Isoform 3 (identifier: O43184-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     114-116: Missing.
     705-738: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL → EARQEAAESNRERGQGQEPVGSQEHASTASLTLI
     739-909: Missing.

Show »
Length:735
Mass (Da):80,078
Checksum:i664D4EDA47F8B533
GO
Isoform 4 (identifier: O43184-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     114-116: Missing.
     705-740: DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFT → GKEARQEAAESNRERGQGQEPVGSQEHASTASLTLI
     741-909: Missing.

Show »
Length:737
Mass (Da):80,263
Checksum:iD86FE821BCBC62C6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JRP2Q5JRP2_HUMAN
Disintegrin and metalloproteinase d...
ADAM12
906Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03854248G → R4 PublicationsCorresponds to variant dbSNP:rs3740199Ensembl.1
Natural variantiVAR_036143301D → H in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_036144479G → E in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1459457663Ensembl.1
Natural variantiVAR_066310712G → E in a cutaneous metastatic melanoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_036145792L → F in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_066311893P → S in a cutaneous metastatic melanoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs151030407Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031001114 – 116Missing in isoform 3 and isoform 4. 2 Publications3
Alternative sequenceiVSP_031002705 – 740DNQGL…RLLFT → GKEARQEAAESNRERGQGQE PVGSQEHASTASLTLI in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_005476705 – 738DNQGL…LIRLL → EARQEAAESNRERGQGQEPV GSQEHASTASLTLI in isoform 2 and isoform 3. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_005477739 – 909Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST171
Alternative sequenceiVSP_031003741 – 909Missing in isoform 4. 1 PublicationAdd BLAST169

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF023476 mRNA Translation: AAC08702.2
AF023477 mRNA Translation: AAC08703.2
AY358878 mRNA Translation: AAQ89237.1
AC022015 Genomic DNA No translation available.
AC026226 Genomic DNA No translation available.
AC063963 Genomic DNA No translation available.
AL589787 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49206.1
CH471066 Genomic DNA Translation: EAW49209.1
BC060804 mRNA Translation: AAH60804.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS7653.1 [O43184-1]
CCDS7654.1 [O43184-2]

NCBI Reference Sequences

More...RefSeqi		NP_001275903.1, NM_001288974.1 [O43184-4]
NP_001275904.1, NM_001288975.1 [O43184-3]
NP_003465.3, NM_003474.5 [O43184-1]
NP_067673.2, NM_021641.4 [O43184-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000368676.8; ENSP00000357665.4; ENSG00000148848.15 [O43184-2]
ENST00000368679.8; ENSP00000357668.4; ENSG00000148848.15

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8038

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8038

UCSC genome browser

More...UCSCi		uc001ljk.4, human [O43184-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF023476 mRNA Translation: AAC08702.2
AF023477 mRNA Translation: AAC08703.2
AY358878 mRNA Translation: AAQ89237.1
AC022015 Genomic DNA No translation available.
AC026226 Genomic DNA No translation available.
AC063963 Genomic DNA No translation available.
AL589787 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49206.1
CH471066 Genomic DNA Translation: EAW49209.1
BC060804 mRNA Translation: AAH60804.1
CCDSiCCDS7653.1 [O43184-1]
CCDS7654.1 [O43184-2]
RefSeqiNP_001275903.1, NM_001288974.1 [O43184-4]
NP_001275904.1, NM_001288975.1 [O43184-3]
NP_003465.3, NM_003474.5 [O43184-1]
NP_067673.2, NM_021641.4 [O43184-2]

3D structure databases

AlphaFoldDBiO43184
SMRiO43184
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi113731, 39 interactors
CORUMiO43184
IntActiO43184, 46 interactors
MINTiO43184
STRINGi9606.ENSP00000357668

Chemistry databases

BindingDBiO43184
ChEMBLiCHEMBL5030
GuidetoPHARMACOLOGYi1660

Protein family/group databases

MEROPSiM12.212
TCDBi8.A.77.1.5, the sheddase (sheddase) family

PTM databases

CarbonylDBiO43184
GlyGeniO43184, 5 sites
iPTMnetiO43184
PhosphoSitePlusiO43184

Genetic variation databases

BioMutaiADAM12

Proteomic databases

jPOSTiO43184
MassIVEiO43184
MaxQBiO43184
PaxDbiO43184
PeptideAtlasiO43184
PRIDEiO43184
ProteomicsDBi48799 [O43184-1]
48800 [O43184-2]
48801 [O43184-3]
48802 [O43184-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19223, 474 antibodies from 40 providers

The DNASU plasmid repository

More...DNASUi		8038

Genome annotation databases

EnsembliENST00000368676.8; ENSP00000357665.4; ENSG00000148848.15 [O43184-2]
ENST00000368679.8; ENSP00000357668.4; ENSG00000148848.15
GeneIDi8038
KEGGihsa:8038
UCSCiuc001ljk.4, human [O43184-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8038
DisGeNETi8038

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADAM12
HGNCiHGNC:190, ADAM12
HPAiENSG00000148848, Tissue enriched (placenta)
MIMi602714, gene
neXtProtiNX_O43184
OpenTargetsiENSG00000148848
PharmGKBiPA24507
VEuPathDBiHostDB:ENSG00000148848

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3607, Eukaryota
GeneTreeiENSGT00940000155495
HOGENOMiCLU_012714_7_0_1
InParanoidiO43184
OMAiSYMLEPC
OrthoDBi162519at2759
PhylomeDBiO43184
TreeFamiTF314733

Enzyme and pathway databases

BRENDAi3.4.24.B10, 2681
PathwayCommonsiO43184
ReactomeiR-HSA-177929, Signaling by EGFR
R-HSA-8941237, Invadopodia formation
SignaLinkiO43184
SIGNORiO43184

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8038, 11 hits in 1074 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADAM12, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADAM12

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8038
PharosiO43184, Tchem

Protein Ontology

More...PROi		PR:O43184
RNActiO43184, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000148848, Expressed in placenta and 176 other tissues
ExpressionAtlasiO43184, baseline and differential
GenevisibleiO43184, HS

Family and domain databases

CDDicd04269, ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR006586, ADAM_Cys-rich
IPR018358, Disintegrin_CS
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin
PfamiView protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit
PRINTSiPR00289, DISINTEGRIN
SMARTiView protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit
SUPFAMiSSF57552, SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS00427, DISINTEGRIN_1, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS50026, EGF_3, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA12_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43184
Secondary accession number(s): O60470
, Q5JRP0, Q5JRP1, Q6P9E3, Q6UWB0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 5, 2009
Last modified: May 25, 2022
This is version 205 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again