Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (13 Feb 2019)
Sequence version 3 (03 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho GTPase-activating protein 6

Gene

ARHGAP6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell motility and simultaneous retraction of the cell body changing the cell morphology.1 Publication

Miscellaneous

ARHGAP6 gene undergoes X inactivation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • phospholipase activator activity Source: BHF-UCL
  • phospholipase binding Source: BHF-UCL
  • SH3/SH2 adaptor activity Source: ProtInc
  • SH3 domain binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GTPase-activating protein 6
Alternative name(s):
Rho-type GTPase-activating protein 6
Rho-type GTPase-activating protein RhoGAPX-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGAP6
Synonyms:RHOGAP6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000047648.21

Human Gene Nomenclature Database

More...
HGNCi
HGNC:676 ARHGAP6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300118 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O43182

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
395

Open Targets

More...
OpenTargetsi
ENSG00000047648

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24960

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGAP6

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567041 – 974Rho GTPase-activating protein 6Add BLAST974

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei37PhosphoserineBy similarity1
Modified residuei264PhosphoserineCombined sources1
Modified residuei363PhosphoserineCombined sources1
Modified residuei667PhosphoserineCombined sources1
Modified residuei673PhosphoserineCombined sources1
Modified residuei680PhosphoserineCombined sources1
Modified residuei711PhosphoserineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei772PhosphoserineCombined sources1
Modified residuei777PhosphoserineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei820PhosphoserineCombined sources1
Modified residuei928PhosphoserineCombined sources1
Modified residuei931PhosphoserineCombined sources1
Modified residuei939PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O43182

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O43182

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O43182

PeptideAtlas

More...
PeptideAtlasi
O43182

PRoteomics IDEntifications database

More...
PRIDEi
O43182

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48794
48795 [O43182-2]
48796 [O43182-3]
48797 [O43182-4]
48798 [O43182-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O43182-5 [O43182-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O43182

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O43182

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000047648 Expressed in 208 organ(s), highest expression level in seminal vesicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O43182 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O43182 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036779
HPA064390

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106888, 2 interactors

Protein interaction database and analysis system

More...
IntActi
O43182, 1 interactor

Molecular INTeraction database

More...
MINTi
O43182

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000338967

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O43182

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O43182

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini401 – 602Rho-GAPPROSITE-ProRule annotationAdd BLAST202

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi342 – 352SH3-bindingAdd BLAST11

Keywords - Domaini

SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2710 Eukaryota
ENOG410YVI5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153904

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231644

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG067762

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O43182

KEGG Orthology (KO)

More...
KOi
K20631

Database of Orthologous Groups

More...
OrthoDBi
419555at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O43182

TreeFam database of animal gene trees

More...
TreeFami
TF316710

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008936 Rho_GTPase_activation_prot
IPR030772 RhoGAP6
IPR037863 RHOGAP6/36
IPR000198 RhoGAP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12635 PTHR12635, 1 hit
PTHR12635:SF6 PTHR12635:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00620 RhoGAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00324 RhoGAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50238 RHOGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: O43182-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAQSLLHSV FSCSSPASSS AASAKGFSKR KLRQTRSLDP ALIGGCGSDE
60 70 80 90 100
AGAEGSARGA TAGRLYSPSL PAESLGPRLA SSSRGPPPRA TRLPPPGPLC
110 120 130 140 150
SSFSTPSTPQ EKSPSGSFHF DYEVPLGRGG LKKSMAWDLP SVLAGPASSR
160 170 180 190 200
SASSILCSSG GGPNGIFASP RRWLQQRKFQ SPPDSRGHPY VVWKSEGDFT
210 220 230 240 250
WNSMSGRSVR LRSVPIQSLS ELERARLQEV AFYQLQQDCD LSCQITIPKD
260 270 280 290 300
GQKRKKSLRK KLDSLGKEKN KDKEFIPQAF GMPLSQVIAN DRAYKLKQDL
310 320 330 340 350
QRDEQKDASD FVASLLPFGN KRQNKELSSS NSSLSSTSET PNESTSPNTP
360 370 380 390 400
EPAPRARRRG AMSVDSITDL DDNQSRLLEA LQLSLPAEAQ SKKEKARDKK
410 420 430 440 450
LSLNPIYRQV PRLVDSCCQH LEKHGLQTVG IFRVGSSKKR VRQLREEFDR
460 470 480 490 500
GIDVSLEEEH SVHDVAALLK EFLRDMPDPL LTRELYTAFI NTLLLEPEEQ
510 520 530 540 550
LGTLQLLIYL LPPCNCDTLH RLLQFLSIVA RHADDNISKD GQEVTGNKMT
560 570 580 590 600
SLNLATIFGP NLLHKQKSSD KEFSVQSSAR AEESTAIIAV VQKMIENYEA
610 620 630 640 650
LFMVPPDLQN EVLISLLETD PDVVDYLLRR KASQSSSPDM LQSEVSFSVG
660 670 680 690 700
GRHSSTDSNK ASSGDISPYD NNSPVLSERS LLAMQEDAAP GGSEKLYRVP
710 720 730 740 750
GQFMLVGHLS SSKSRESSPG PRLGKDLSEE PFDIWGTWHS TLKSGSKDPG
760 770 780 790 800
MTGSSGDIFE SSSLRAGPCS LSQGNLSPNW PRWQGSPAEL DSDTQGARRT
810 820 830 840 850
QAAAPATEGR AHPAVSRACS TPHVQVAGKA ERPTARSEQY LTLSGAHDLS
860 870 880 890 900
ESELDVAGLQ SRATPQCQRP HGSGRDDKRP PPPYPGPGKP AAAAAWIQGP
910 920 930 940 950
PEGVETPTDQ GGQAAEREQQ VTQKKLSSAN SLPAGEQDSP RLGDAGWLDW
960 970
QRERWQIWEL LSTDNPDALP ETLV
Length:974
Mass (Da):105,947
Last modified:October 3, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBEE22EB54F019E30
GO
Isoform 1 (identifier: O43182-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:765
Mass (Da):83,926
Checksum:i992B50A957E7019E
GO
Isoform 2 (identifier: O43182-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-196: E → ELELYDLQILGTKPPMNSDTHRNFDPTATLRNQ
     637-658: SPDMLQSEVSFSVGGRHSSTDS → TSSVLPAAVQACPQYPASMFTP
     659-974: Missing.

Show »
Length:690
Mass (Da):75,918
Checksum:iEE1801C208E48DB9
GO
Isoform 4 (identifier: O43182-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.

Show »
Length:771
Mass (Da):84,844
Checksum:iA7CAEADB29590AAF
GO
Isoform 5 (identifier: O43182-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     726-765: DLSEEPFDIW...GDIFESSSLR → GNWSLASRRW...SSSLPYLMFL
     766-974: Missing.

Show »
Length:562
Mass (Da):62,822
Checksum:i96707FB1D7CBFC62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYE6H7BYE6_HUMAN
Rho GTPase-activating protein 6
ARHGAP6
601Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti231A → P in AAF43261 (PubMed:10699171).Curated1
Sequence conflicti231A → P in AAD55087 (PubMed:10699171).Curated1
Sequence conflicti231A → P in AAC98539 (PubMed:9417914).Curated1
Sequence conflicti231A → P in AAC98540 (PubMed:9417914).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024453791D → E1 PublicationCorresponds to variant dbSNP:rs1009758Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0016371 – 203Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_001638196E → ELELYDLQILGTKPPMNSDT HRNFDPTATLRNQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_001639637 – 658SPDML…SSTDS → TSSVLPAAVQACPQYPASMF TP in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_001640659 – 974Missing in isoform 2. 1 PublicationAdd BLAST316
Alternative sequenceiVSP_001641726 – 765DLSEE…SSSLR → GNWSLASRRWPKQATLLLLH VAWCGALRTFSSSLPYLMFL in isoform 1 and isoform 5. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_001642766 – 974Missing in isoform 1 and isoform 5. 2 PublicationsAdd BLAST209

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF117067 mRNA Translation: AAF43261.1
AF177663 mRNA Translation: AAD53166.1
AF177665 mRNA Translation: AAD55087.1
AF012272 mRNA Translation: AAC98539.2
AF022212 mRNA Translation: AAC98540.2
BC150635 mRNA Translation: AAI50636.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14140.1 [O43182-1]
CCDS14141.1 [O43182-4]
CCDS14142.1 [O43182-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
E59434

NCBI Reference Sequences

More...
RefSeqi
NP_001274171.1, NM_001287242.1
NP_006116.2, NM_006125.2 [O43182-2]
NP_038267.1, NM_013423.2 [O43182-4]
NP_038286.2, NM_013427.2 [O43182-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.435291

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000303025; ENSP00000302312; ENSG00000047648 [O43182-4]
ENST00000337414; ENSP00000338967; ENSG00000047648 [O43182-1]
ENST00000380718; ENSP00000370094; ENSG00000047648 [O43182-2]
ENST00000380736; ENSP00000370112; ENSG00000047648 [O43182-4]
ENST00000495242; ENSP00000435767; ENSG00000047648 [O43182-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
395

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:395

UCSC genome browser

More...
UCSCi
uc004cum.2 human [O43182-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117067 mRNA Translation: AAF43261.1
AF177663 mRNA Translation: AAD53166.1
AF177665 mRNA Translation: AAD55087.1
AF012272 mRNA Translation: AAC98539.2
AF022212 mRNA Translation: AAC98540.2
BC150635 mRNA Translation: AAI50636.1
CCDSiCCDS14140.1 [O43182-1]
CCDS14141.1 [O43182-4]
CCDS14142.1 [O43182-2]
PIRiE59434
RefSeqiNP_001274171.1, NM_001287242.1
NP_006116.2, NM_006125.2 [O43182-2]
NP_038267.1, NM_013423.2 [O43182-4]
NP_038286.2, NM_013427.2 [O43182-1]
UniGeneiHs.435291

3D structure databases

ProteinModelPortaliO43182
SMRiO43182
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106888, 2 interactors
IntActiO43182, 1 interactor
MINTiO43182
STRINGi9606.ENSP00000338967

PTM databases

iPTMnetiO43182
PhosphoSitePlusiO43182

Polymorphism and mutation databases

BioMutaiARHGAP6

Proteomic databases

jPOSTiO43182
MaxQBiO43182
PaxDbiO43182
PeptideAtlasiO43182
PRIDEiO43182
ProteomicsDBi48794
48795 [O43182-2]
48796 [O43182-3]
48797 [O43182-4]
48798 [O43182-5]
TopDownProteomicsiO43182-5 [O43182-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000303025; ENSP00000302312; ENSG00000047648 [O43182-4]
ENST00000337414; ENSP00000338967; ENSG00000047648 [O43182-1]
ENST00000380718; ENSP00000370094; ENSG00000047648 [O43182-2]
ENST00000380736; ENSP00000370112; ENSG00000047648 [O43182-4]
ENST00000495242; ENSP00000435767; ENSG00000047648 [O43182-3]
GeneIDi395
KEGGihsa:395
UCSCiuc004cum.2 human [O43182-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
395
DisGeNETi395
EuPathDBiHostDB:ENSG00000047648.21

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGAP6
HGNCiHGNC:676 ARHGAP6
HPAiHPA036779
HPA064390
MIMi300118 gene
neXtProtiNX_O43182
OpenTargetsiENSG00000047648
PharmGKBiPA24960

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2710 Eukaryota
ENOG410YVI5 LUCA
GeneTreeiENSGT00940000153904
HOGENOMiHOG000231644
HOVERGENiHBG067762
InParanoidiO43182
KOiK20631
OrthoDBi419555at2759
PhylomeDBiO43182
TreeFamiTF316710

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARHGAP6 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
395

Protein Ontology

More...
PROi
PR:O43182

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000047648 Expressed in 208 organ(s), highest expression level in seminal vesicle
ExpressionAtlasiO43182 baseline and differential
GenevisibleiO43182 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
InterProiView protein in InterPro
IPR008936 Rho_GTPase_activation_prot
IPR030772 RhoGAP6
IPR037863 RHOGAP6/36
IPR000198 RhoGAP_dom
PANTHERiPTHR12635 PTHR12635, 1 hit
PTHR12635:SF6 PTHR12635:SF6, 1 hit
PfamiView protein in Pfam
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50238 RHOGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHG06_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O43182
Secondary accession number(s): B2RWQ0
, O43437, Q9P1B3, Q9UK81, Q9UK82
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: October 3, 2006
Last modified: February 13, 2019
This is version 167 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again