Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 87 (02 Jun 2021)
Sequence version 2 (27 Apr 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear autoantigen Sp-100

Gene

Sp100

Organism
Mus caroli (Ryukyu mouse) (Ricefield mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Together with PML, this tumor suppressor is a major constituent of the PML bodies, a subnuclear organelle involved in a large number of physiological processes including cell growth, differentiation and apoptosis. Functions as a transcriptional coactivator of ETS1 and ETS2. Under certain conditions, it may also act as a corepressor of ETS1 preventing its binding to DNA. Through the regulation of ETS1 it may play a role in angiogenesis, controlling endothelial cell motility and invasion. Through interaction with the MRN complex it may be involved in the regulation of telomeres lengthening. May also regulate TP53-mediated transcription and through CASP8AP2, regulate FAS-mediated apoptosis. May also play a role in infection by viruses through mechanisms that may involve chromatin and/or transcriptional regulation (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear autoantigen Sp-100
Alternative name(s):
Nuclear dot-associated Sp100 protein
Speckled 100 kDa
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sp100
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus caroli (Ryukyu mouse) (Ricefield mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10089 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:109561, Sp100

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000740991 – 482Nuclear autoantigen Sp-100Add BLAST482

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei174PhosphoserineBy similarity1
Modified residuei190PhosphoserineBy similarity1
Modified residuei209PhosphothreonineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki243Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Modified residuei313PhosphothreonineBy similarity1
Modified residuei314PhosphoserineBy similarity1
Modified residuei316PhosphothreonineBy similarity1
Modified residuei318PhosphoserineBy similarity1
Modified residuei319PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated. Sumoylated with SUMO1. Sumoylation depends on a functional nuclear localization signal but is not necessary for nuclear import or nuclear body targeting. Sumoylation may stabilize the interaction with CBX5 (By similarity).By similarity
Phosphorylated.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By interferon.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with members of the HP1 family of nonhistone chromosomal protein, such as CBX5 and CBX3 via the PxVxL motif.

Interacts with ETS1; the interaction is direct and modulates ETS1 transcriptional activity.

Interacts with the MRN complex which is composed of two heterodimers RAD50/MRE11 associated with a single NBN; recruits the complex to PML-related bodies.

Interacts with HIPK2; positively regulates TP53-dependent transcription.

Interacts with CASP8AP2; may negatively regulate CASP8AP2 export from the nucleus to the cytoplasm (By similarity).

By similarity

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O35893

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 121HSRPROSITE-ProRule annotationAdd BLAST116
Domaini378 – 459SANDPROSITE-ProRule annotationAdd BLAST82

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni131 – 171DisorderedSequence analysisAdd BLAST41
Regioni250 – 334DisorderedSequence analysisAdd BLAST85
Regioni357 – 382DisorderedSequence analysisAdd BLAST26
Regioni457 – 482DisorderedSequence analysisAdd BLAST26

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi230 – 243PxVxL motifAdd BLAST14
Motifi309 – 326Nuclear localization signalSequence analysisAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi250 – 270Polar residuesSequence analysisAdd BLAST21
Compositional biasi277 – 295Polar residuesSequence analysisAdd BLAST19
Compositional biasi305 – 323Basic and acidic residuesSequence analysisAdd BLAST19

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The HSR domain is important for the nuclear body targeting as well as for the dimerization.
Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain.

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004865, HSR_dom
IPR010919, SAND-like_dom_sf
IPR000770, SAND_dom
IPR043563, Sp110/Sp140/Sp140L

The PANTHER Classification System

More...
PANTHERi
PTHR46386, PTHR46386, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03172, HSR, 1 hit
PF01342, SAND, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00258, SAND, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63763, SSF63763, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51414, HSR, 1 hit
PS50864, SAND, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O35893-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDSNASPRM STEHENTEMH PFEYMFKHFK TQKVAISNAI RSTFPFLESL
60 70 80 90 100
RDREFITGKM YEDLIDSCRS LVPVDKVIYK ALDELEKKFD VTVLWELFNE
110 120 130 140 150
VNMEKYPDLN PIRRSFECVF PNELSFQGID RGNPNSQLSL EQGPSASYSQ
160 170 180 190 200
GSLNGSSLDL SSSEGWRSND RRNSNLMQAN QTENHQLAES PGHLDSCELQ
210 220 230 240 250
VQLNNGDATP ESYSLLPQHE ERAVQLNNEF QINPCFVQLI DVKKENSSFS
260 270 280 290 300
LAGNQQTRAR TNQNEDSEVI ELSSGDSDDG ENFSEATTTI PSQPAPAYSR
310 320 330 340 350
TPPTLRTDRR GDTSDTESSI IIRRRKRTGR KKRERLGSYL IRNIKIPMKT
360 370 380 390 400
SWKTAVLARS ANTSSQRRRK RGPRIPREEN ADFGGAELPA VCGNVQGFLN
410 420 430 440 450
KEKFKQGIYV RSIRSETGRL FTPMDFEIEG NCEKAKNWRQ TIRCKGWTLR
460 470 480
ELIQKGVLQD PPRKKKENPR NPRQMKRQVN AL
Length:482
Mass (Da):55,168
Last modified:April 27, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A9B40576CE98686
GO
Isoform 2 (identifier: O35893-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-330: DTSDTESSIIIRRRKRTGR → G

Show »
Length:464
Mass (Da):52,995
Checksum:iC95EE579E3F83425
GO
Isoform 3 (identifier: O35893-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-225: RAVQ → SNYC
     226-482: Missing.

Show »
Length:225
Mass (Da):25,774
Checksum:iD2728D7F23F8165B
GO
Isoform 4 (identifier: O35893-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-302: VIELSSGDSDDGENFSEATTTIPSQPAPAYSRTP → NSAVGILMMERTSQKLQPQSPPSQRLHIPEHLQH
     303-482: Missing.

Show »
Length:302
Mass (Da):34,543
Checksum:i73CB2194921EC0D1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61Y → H in AAC53509 (PubMed:9268632).Curated1
Sequence conflicti65I → V in AAC53509 (PubMed:9268632).Curated1
Sequence conflicti76K → R in AAC53508 (PubMed:9268632).Curated1
Sequence conflicti102N → D in AAC53510 (PubMed:9268632).Curated1
Sequence conflicti118 – 119CV → L in AAC53511 (PubMed:9268632).Curated2
Sequence conflicti184N → D in AAC53508 (PubMed:9268632).Curated1
Sequence conflicti186Q → P in AAC53511 (PubMed:9268632).Curated1
Sequence conflicti200Q → R in AAC53509 (PubMed:9268632).Curated1
Sequence conflicti295A → V in AAC12948 (PubMed:9268632).Curated1
Sequence conflicti295A → V in AAC53506 (PubMed:9268632).Curated1
Sequence conflicti390A → V in AAC12948 (PubMed:9268632).Curated1
Sequence conflicti390A → V in AAC53506 (PubMed:9268632).Curated1
Sequence conflicti390A → V in AAC53509 (PubMed:9268632).Curated1
Sequence conflicti410V → S in AAC12948 (PubMed:9268632).Curated1
Sequence conflicti410V → S in AAC53506 (PubMed:9268632).Curated1
Sequence conflicti455K → Q in AAC12948 (PubMed:9268632).Curated1
Sequence conflicti455K → Q in AAC53506 (PubMed:9268632).Curated1
Sequence conflicti468N → T in AAC12948 (PubMed:9268632).Curated1
Sequence conflicti468N → T in AAC53506 (PubMed:9268632).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005986222 – 225RAVQ → SNYC in isoform 3. 1 Publication4
Alternative sequenceiVSP_005987226 – 482Missing in isoform 3. 1 PublicationAdd BLAST257
Alternative sequenceiVSP_005989269 – 302VIELS…YSRTP → NSAVGILMMERTSQKLQPQS PPSQRLHIPEHLQH in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_005990303 – 482Missing in isoform 4. 1 PublicationAdd BLAST180
Alternative sequenceiVSP_005988312 – 330DTSDT…KRTGR → G in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U83629 mRNA Translation: AAC53506.1
U83631 mRNA Translation: AAC53507.1
U83632 mRNA Translation: AAC53508.1
U83633 mRNA Translation: AAC53509.1
U83634 mRNA Translation: AAC53510.1
U83635 mRNA Translation: AAC53511.1
U83654 U83653 Genomic DNA Translation: AAC12948.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83629 mRNA Translation: AAC53506.1
U83631 mRNA Translation: AAC53507.1
U83632 mRNA Translation: AAC53508.1
U83633 mRNA Translation: AAC53509.1
U83634 mRNA Translation: AAC53510.1
U83635 mRNA Translation: AAC53511.1
U83654 U83653 Genomic DNA Translation: AAC12948.1

3D structure databases

SMRiO35893
ModBaseiSearch...

Organism-specific databases

MGIiMGI:109561, Sp100

Family and domain databases

Gene3Di3.10.390.10, 1 hit
InterProiView protein in InterPro
IPR004865, HSR_dom
IPR010919, SAND-like_dom_sf
IPR000770, SAND_dom
IPR043563, Sp110/Sp140/Sp140L
PANTHERiPTHR46386, PTHR46386, 2 hits
PfamiView protein in Pfam
PF03172, HSR, 1 hit
PF01342, SAND, 1 hit
SMARTiView protein in SMART
SM00258, SAND, 1 hit
SUPFAMiSSF63763, SSF63763, 1 hit
PROSITEiView protein in PROSITE
PS51414, HSR, 1 hit
PS50864, SAND, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSP100_MUSCR
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O35893
Secondary accession number(s): O35894
, O35895, O35896, O35974, Q9QWH0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: April 27, 2001
Last modified: June 2, 2021
This is version 87 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again