Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 18

Gene

Tnfrsf18

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processApoptosis

Enzyme and pathway databases

ReactomeiR-MMU-5669034 TNFs bind their physiological receptors

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 18
Alternative name(s):
Glucocorticoid-induced TNFR-related protein
CD_antigen: CD357
Gene namesi
Name:Tnfrsf18
Synonyms:Gitr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:894675 Tnfrsf18

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini20 – 153ExtracellularSequence analysisAdd BLAST134
Transmembranei154 – 174HelicalSequence analysisAdd BLAST21
Topological domaini175 – 228CytoplasmicSequence analysisAdd BLAST54

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi199S → A: Does not bind to SIVA1. 1 Publication1
Mutagenesisi201E → R: No effect on binding to SIVA1; when associated with G-204. 1 Publication1
Mutagenesisi204C → G: No effect on binding to SIVA1; when associated with R-201. 1 Publication1
Mutagenesisi209P → A: Does not bind to SIVA1. 1 Publication1
Mutagenesisi210 – 212EEE → RVV: Does not bind to SIVA1. 1 Publication3

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000003459620 – 228Tumor necrosis factor receptor superfamily member 18Add BLAST209

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi29 ↔ 44By similarity
Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi40N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi62 ↔ 74By similarity
Disulfide bondi69 ↔ 82By similarity
Disulfide bondi103 ↔ 122By similarity
Disulfide bondi116 ↔ 141By similarity
Glycosylationi121N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi134N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiO35714
PRIDEiO35714

Expressioni

Tissue specificityi

Preferentially expressed in activated T lymphocytes.

Inductioni

Up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.

Gene expression databases

BgeeiENSMUSG00000041954 Expressed in 63 organ(s), highest expression level in thymus
ExpressionAtlasiO35714 baseline and differential
GenevisibleiO35714 MM

Interactioni

Subunit structurei

Binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 (By similarity). Binds through its C-terminus to SIVA1/SIVA.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Tnfsf18Q7TS554EBI-523358,EBI-523345

Protein-protein interaction databases

BioGridi204248, 1 interactor
DIPiDIP-29666N
IntActiO35714, 1 interactor
STRINGi10090.ENSMUSP00000099462

Structurei

3D structure databases

ProteinModelPortaliO35714
SMRiO35714
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati28 – 61TNFR-Cys 1Add BLAST34
Repeati62 – 101TNFR-Cys 2Add BLAST40
Repeati102 – 142TNFR-Cys 3Add BLAST41

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J0PX Eukaryota
ENOG410YX1D LUCA
GeneTreeiENSGT00730000111424
HOGENOMiHOG000049155
HOVERGENiHBG054195
InParanoidiO35714
KOiK05154
OMAiRCKPWAD
TreeFamiTF336151

Family and domain databases

CDDicd13417 TNFRSF18, 1 hit
InterProiView protein in InterPro
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR022318 TNFR_18
IPR034018 TNFRSF18_N
PRINTSiPR01968 TNFACTORR18
SMARTiView protein in SMART
SM00208 TNFR, 2 hits

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: O35714-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAWAMLYGV SMLCVLDLGQ PSVVEEPGCG PGKVQNGSGN NTRCCSLYAP
60 70 80 90 100
GKEDCPKERC ICVTPEYHCG DPQCKICKHY PCQPGQRVES QGDIVFGFRC
110 120 130 140 150
VACAMGTFSA GRDGHCRLWT NCSQFGFLTM FPGNKTHNAV CIPEPLPTEQ
160 170 180 190 200
YGHLTVIFLV MAACIFFLTT VQLGLHIWQL RRQHMCPRET QPFAEVQLSA
210 220
EDACSFQFPE EERGEQTEEK CHLGGRWP
Length:228
Mass (Da):25,334
Last modified:January 1, 1998 - v1
Checksum:i50D8C275D9C56259
GO
Isoform B (identifier: O35714-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-228: ETQPFAEVQL...EKCHLGGRWP → VLLQRPSHSR...RLGPMAAFLI

Show »
Length:294
Mass (Da):32,658
Checksum:iFE0D4AE6A007BA9A
GO
Isoform C (identifier: O35714-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-228: ETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP → GQLCPREGENVSQAPHLPQFYYRDPAIRGGAVVS

Show »
Length:222
Mass (Da):24,450
Checksum:i594932BA425A79CA
GO
Isoform D (identifier: O35714-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-228: NCSQFGFLTM...EKCHLGGRWP → KDPAIRGGAVVS

Show »
Length:132
Mass (Da):14,106
Checksum:iF586A5404B1DFEDE
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1ASL6B1ASL6_MOUSE
Tumor necrosis factor receptor supe...
Tnfrsf18
314Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006509121 – 228NCSQF…GGRWP → KDPAIRGGAVVS in isoform D. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_006510189 – 228ETQPF…GGRWP → VLLQRPSHSRRCSCQLRMLA ASSSLRRNAGSRQKKSVIWG VGGHEAWSSSVPQARRYKTC PAIPLVRAGAMLCTLPWAWP CSPQQWRKWVYESGELRLGP MAAFLI in isoform B. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_006511189 – 228ETQPF…GGRWP → GQLCPREGENVSQAPHLPQF YYRDPAIRGGAVVS in isoform C. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82534 mRNA Translation: AAB81243.1
AF109216 Genomic DNA Translation: AAF14231.1
AF229432 mRNA Translation: AAF61566.1
AF229433 mRNA Translation: AAF61567.1
AF229434 mRNA Translation: AAF61568.1
AK020762 mRNA Translation: BAC25639.1
CCDSiCCDS19056.1 [O35714-1]
CCDS19057.1 [O35714-4]
RefSeqiNP_033426.1, NM_009400.2 [O35714-1]
NP_068820.1, NM_021985.2 [O35714-4]
UniGeneiMm.3180

Genome annotation databases

EnsembliENSMUST00000040274; ENSMUSP00000040035; ENSMUSG00000041954 [O35714-4]
ENSMUST00000103173; ENSMUSP00000099462; ENSMUSG00000041954 [O35714-1]
GeneIDi21936
KEGGimmu:21936
UCSCiuc008wfw.1 mouse [O35714-4]
uc008wfx.1 mouse [O35714-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82534 mRNA Translation: AAB81243.1
AF109216 Genomic DNA Translation: AAF14231.1
AF229432 mRNA Translation: AAF61566.1
AF229433 mRNA Translation: AAF61567.1
AF229434 mRNA Translation: AAF61568.1
AK020762 mRNA Translation: BAC25639.1
CCDSiCCDS19056.1 [O35714-1]
CCDS19057.1 [O35714-4]
RefSeqiNP_033426.1, NM_009400.2 [O35714-1]
NP_068820.1, NM_021985.2 [O35714-4]
UniGeneiMm.3180

3D structure databases

ProteinModelPortaliO35714
SMRiO35714
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204248, 1 interactor
DIPiDIP-29666N
IntActiO35714, 1 interactor
STRINGi10090.ENSMUSP00000099462

Proteomic databases

PaxDbiO35714
PRIDEiO35714

Protocols and materials databases

DNASUi21936
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000040274; ENSMUSP00000040035; ENSMUSG00000041954 [O35714-4]
ENSMUST00000103173; ENSMUSP00000099462; ENSMUSG00000041954 [O35714-1]
GeneIDi21936
KEGGimmu:21936
UCSCiuc008wfw.1 mouse [O35714-4]
uc008wfx.1 mouse [O35714-1]

Organism-specific databases

CTDi8784
MGIiMGI:894675 Tnfrsf18

Phylogenomic databases

eggNOGiENOG410J0PX Eukaryota
ENOG410YX1D LUCA
GeneTreeiENSGT00730000111424
HOGENOMiHOG000049155
HOVERGENiHBG054195
InParanoidiO35714
KOiK05154
OMAiRCKPWAD
TreeFamiTF336151

Enzyme and pathway databases

ReactomeiR-MMU-5669034 TNFs bind their physiological receptors

Miscellaneous databases

PROiPR:O35714
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000041954 Expressed in 63 organ(s), highest expression level in thymus
ExpressionAtlasiO35714 baseline and differential
GenevisibleiO35714 MM

Family and domain databases

CDDicd13417 TNFRSF18, 1 hit
InterProiView protein in InterPro
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR022318 TNFR_18
IPR034018 TNFRSF18_N
PRINTSiPR01968 TNFACTORR18
SMARTiView protein in SMART
SM00208 TNFR, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiTNR18_MOUSE
AccessioniPrimary (citable) accession number: O35714
Secondary accession number(s): Q9JKR1, Q9JKR2, Q9JKR3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again