Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (08 May 2019)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pro-neuregulin-2, membrane-bound isoform

Gene

Nrg2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-1227986 Signaling by ERBB2
R-RNO-1236394 Signaling by ERBB4
R-RNO-1250196 SHC1 events in ERBB2 signaling
R-RNO-1250342 PI3K events in ERBB4 signaling
R-RNO-1250347 SHC1 events in ERBB4 signaling
R-RNO-1257604 PIP3 activates AKT signaling
R-RNO-1306955 GRB7 events in ERBB2 signaling
R-RNO-1358803 Downregulation of ERBB2:ERBB3 signaling
R-RNO-1963640 GRB2 events in ERBB2 signaling
R-RNO-1963642 PI3K events in ERBB2 signaling
R-RNO-5673001 RAF/MAP kinase cascade
R-RNO-6785631 ERBB2 Regulates Cell Motility
R-RNO-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-RNO-8847993 ERBB2 Activates PTK6 Signaling
R-RNO-8863795 Downregulation of ERBB2 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pro-neuregulin-2, membrane-bound isoform
Short name:
Pro-NRG2
Cleaved into the following chain:
Neuregulin-2
Short name:
NRG-2
Alternative name(s):
Neural- and thymus-derived activator for ERBB kinases
Short name:
NTAK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nrg2
Synonyms:Ntak
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
1303302 Nrg2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini128 – 429ExtracellularSequence analysisAdd BLAST302
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei430 – 450Helical; Note=Internal signal sequenceSequence analysisAdd BLAST21
Topological domaini451 – 868CytoplasmicSequence analysisAdd BLAST418

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000194781 – 1271 PublicationAdd BLAST127
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000019479128 – 868Pro-neuregulin-2, membrane-bound isoformAdd BLAST741
ChainiPRO_0000019480128 – 428Neuregulin-2Add BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi34N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi273 ↔ 327By similarity
Glycosylationi294N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi361 ↔ 375By similarity
Glycosylationi362N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi369 ↔ 386By similarity
Disulfide bondi388 ↔ 397By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.By similarity
Extensive glycosylation precedes the proteolytic cleavage.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O35569

PRoteomics IDEntifications database

More...
PRIDEi
O35569

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O35569

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in most parts of the brain, especially the olfactory bulb and cerebellum where it localizes in granule and Purkinje cells. In the hippocampus, found in the granule cells of the dentate gyrus. In the basal forebrain, found in the cholinergic cells. In the hindbrain, weakly detectable in the motor trigeminal nucleus. Not detected in the hypothalamus. Also found in the liver and in the thymus. Not detected in heart, adrenal gland, or testis.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In the embryo, expressed in the brain of E11.5 embryos where it is found in the telencephalon, but not in the hindbrain. Not found in the heart. In the adult, found in brain and thymus.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ERBB3 and ERBB4.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
268631, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000025901

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O35569

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini253 – 348Ig-like C2-typeAdd BLAST96
Domaini357 – 398EGF-likePROSITE-ProRule annotationAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi22 – 32Poly-SerAdd BLAST11
Compositional biasi35 – 45Poly-SerAdd BLAST11
Compositional biasi56 – 59Poly-Thr4
Compositional biasi103 – 106Poly-Ala4
Compositional biasi346 – 356Ser/Thr-richAdd BLAST11
Compositional biasi739 – 745Poly-Pro7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization (By similarity).By similarity
ERBB receptor binding is elicited entirely by the EGF-like domain.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neuregulin family.Curated

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGZW Eukaryota
ENOG410Y95Z LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000273863

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O35569

KEGG Orthology (KO)

More...
KOi
K05456

Database of Orthologous Groups

More...
OrthoDBi
313400at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O35569

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C

The PANTHER Classification System

More...
PANTHERi
PTHR11100 PTHR11100, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. The alpha-type and beta-type differ in the EGF-like domain.

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O35569-1) [UniParc]FASTAAdd to basket
Also known as: NTAK-alpha1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRQVCCSALP PPLEKARCSS YSYSDSSSSS SSNNSSSSTS SRSSSRSSSR
60 70 80 90 100
SSRGSTTTTS SSENSGSNSG SIFRPAAPPE PRPQPQPQPR SPAARRAAAR
110 120 130 140 150
SRAAAAGGMR RDPAPGSSML LFGVSLACYS PSLKSVQDQA YKAPVVVEGK
160 170 180 190 200
VQGLAPAGGS SSNSTREPPA SGRVALVKVL DKWPLRSGGL QREQVISVGS
210 220 230 240 250
CAPLERNQRY IFFLEPTEQP LVFKTAFAPV DPNGKNIKKE VGKILCTDCA
260 270 280 290 300
TRPKLKKMKS QTGEVGEKQS LKCEAAAGNP QPSYRWFKDG KELNRSRDIR
310 320 330 340 350
IKYGNGRKNS RLQFNKVKVE DAGEYVCEAE NILGKDTVRG RLHVNSVSTT
360 370 380 390 400
LSSWSGHARK CNETAKSYCV NGGVCYYIEG INQLSCKCPN GFFGQRCLEK
410 420 430 440 450
LPLRLYMPDP KQKHLGFELK EAEELYQKRV LTITGICVAL LVVGIVCVVA
460 470 480 490 500
YCKTKKQRRQ MHHHLRQNMC PAHQNRSLAN GPSHPRLDPE EIQMADYISK
510 520 530 540 550
NVPATDHVIR REAETTFSGS HSCSPSHHCS TATPTSSHRH ESHTWSLERS
560 570 580 590 600
ESLTSDSQSG IMLSSVGTSK CNSPACVEAR ARRAAAYSQE ERRRAAMPPY
610 620 630 640 650
HDSIDSLRDS PHSERYVSAL TTPARLSPVD FHYSLATQVP TFEITSPNSA
660 670 680 690 700
HAVSLPPAAP ISYRLAEQQP LLRHPAPPGP GPGPGADMQR SYDSYYYPAA
710 720 730 740 750
GPGPRRGACA LGGSLGSLPA SPFRIPEDDE YETTQECAPP PPPRPRTRGA
760 770 780 790 800
SRRTSAGPRR WRRSRLNGLA AQRARAARDS LSLSSGSGCG SASASDDDAD
810 820 830 840 850
DADGALAAES TPFLGLRAAH DALRSDSPPL CPAADSRTYY SLDSHSTRAS
860
SRHSRGPPTR AKQDSGPL
Length:868
Mass (Da):93,777
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3C7D4D94DBE64DE2
GO
Isoform 2 (identifier: O35569-2) [UniParc]FASTAAdd to basket
Also known as: NTAK-alpha2A

The sequence of this isoform differs from the canonical sequence as follows:
     414-421: Missing.

Show »
Length:860
Mass (Da):92,823
Checksum:iEA4BDB193DDAFFC7
GO
Isoform 3 (identifier: O35569-3) [UniParc]FASTAAdd to basket
Also known as: NTAK-alpha2B, NTAK-alpha2-1P

The sequence of this isoform differs from the canonical sequence as follows:
     220-222: PLV → FFF
     414-421: Missing.

Show »
Length:860
Mass (Da):92,955
Checksum:iE14192395B98AE9E
GO
Isoform 4 (identifier: O35569-4) [UniParc]FASTAAdd to basket
Also known as: NTAK-beta

The sequence of this isoform differs from the canonical sequence as follows:
     390-421: NGFFGQRCLEKLPLRLYMPDPKQKHLGFELKE → VGYTGDRCQQFAMVNFSK

Show »
Length:854
Mass (Da):91,995
Checksum:iF78A98550A869D4A
GO
Isoform 5 (identifier: O35569-5) [UniParc]FASTAAdd to basket
Also known as: NTAK-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     388-388: C → G
     389-868: Missing.

Show »
Length:388
Mass (Da):41,620
Checksum:i848108D986E87F7F
GO
Isoform 6 (identifier: O35569-6) [UniParc]FASTAAdd to basket
Also known as: NRG2-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     414-439: HLGFELKEAEELYQKRVLTITGICVA → SVLWDTPGTGVSSSQWSTSPSTLDLN
     440-868: Missing.

Show »
Length:439
Mass (Da):47,329
Checksum:i82D98EFB30FE37FD
GO
Isoform 7 (identifier: O35569-7) [UniParc]FASTAAdd to basket
Also known as: NRG2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     390-412: NGFFGQRCLEKLPLRLYMPDPKQ → VGYTGDRCQQFAMVNFS

Show »
Length:754
Mass (Da):81,951
Checksum:iBE1E4E3548FE65E2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D4A078D4A078_RAT
Pro-neuregulin-2, membrane-bound is...
Nrg2
860Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1LM11F1LM11_RAT
Pro-neuregulin-2, membrane-bound is...
Nrg2
617Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti117S → F (PubMed:9168114).Curated1
Sequence conflicti724R → H (PubMed:9168114).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0034651 – 108Missing in isoform 7. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_003466220 – 222PLV → FFF in isoform 3. Curated3
Alternative sequenceiVSP_003467388C → G in isoform 5. Curated1
Alternative sequenceiVSP_003468389 – 868Missing in isoform 5. CuratedAdd BLAST480
Alternative sequenceiVSP_003470390 – 421NGFFG…FELKE → VGYTGDRCQQFAMVNFSK in isoform 4. CuratedAdd BLAST32
Alternative sequenceiVSP_003469390 – 412NGFFG…PDPKQ → VGYTGDRCQQFAMVNFS in isoform 7. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_003472414 – 439HLGFE…GICVA → SVLWDTPGTGVSSSQWSTSP STLDLN in isoform 6. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_003471414 – 421Missing in isoform 2 and isoform 3. Curated8
Alternative sequenceiVSP_003473440 – 868Missing in isoform 6. 1 PublicationAdd BLAST429

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D89995 mRNA Translation: BAA23344.1
D89996 mRNA Translation: BAA23345.1
D89997 mRNA Translation: BAA23346.1
D89998 mRNA Translation: BAA23347.1
AB001576 mRNA Translation: BAA23348.1

Protein sequence database of the Protein Information Resource

More...
PIRi
JC5701
JC5702

NCBI Reference Sequences

More...
RefSeqi
NP_001129623.1, NM_001136151.1 [O35569-2]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
432361

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:432361

UCSC genome browser

More...
UCSCi
RGD:1303302 rat [O35569-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D89995 mRNA Translation: BAA23344.1
D89996 mRNA Translation: BAA23345.1
D89997 mRNA Translation: BAA23346.1
D89998 mRNA Translation: BAA23347.1
AB001576 mRNA Translation: BAA23348.1
PIRiJC5701
JC5702
RefSeqiNP_001129623.1, NM_001136151.1 [O35569-2]

3D structure databases

SMRiO35569
ModBaseiSearch...

Protein-protein interaction databases

BioGridi268631, 2 interactors
STRINGi10116.ENSRNOP00000025901

PTM databases

PhosphoSitePlusiO35569

Proteomic databases

PaxDbiO35569
PRIDEiO35569

Genome annotation databases

GeneIDi432361
KEGGirno:432361
UCSCiRGD:1303302 rat [O35569-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9542
RGDi1303302 Nrg2

Phylogenomic databases

eggNOGiENOG410IGZW Eukaryota
ENOG410Y95Z LUCA
HOGENOMiHOG000273863
InParanoidiO35569
KOiK05456
OrthoDBi313400at2759
PhylomeDBiO35569

Enzyme and pathway databases

ReactomeiR-RNO-1227986 Signaling by ERBB2
R-RNO-1236394 Signaling by ERBB4
R-RNO-1250196 SHC1 events in ERBB2 signaling
R-RNO-1250342 PI3K events in ERBB4 signaling
R-RNO-1250347 SHC1 events in ERBB4 signaling
R-RNO-1257604 PIP3 activates AKT signaling
R-RNO-1306955 GRB7 events in ERBB2 signaling
R-RNO-1358803 Downregulation of ERBB2:ERBB3 signaling
R-RNO-1963640 GRB2 events in ERBB2 signaling
R-RNO-1963642 PI3K events in ERBB2 signaling
R-RNO-5673001 RAF/MAP kinase cascade
R-RNO-6785631 ERBB2 Regulates Cell Motility
R-RNO-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-RNO-8847993 ERBB2 Activates PTK6 Signaling
R-RNO-8863795 Downregulation of ERBB2 signaling

Miscellaneous databases

Protein Ontology

More...
PROi
PR:O35569

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR040180 Neuregulin
IPR002154 Neuregulin_C
PANTHERiPTHR11100 PTHR11100, 1 hit
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF02158 Neuregulin, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00408 IGc2, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 1 hit
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRG2_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O35569
Secondary accession number(s): O35073
, O35570, O35571, O35572
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: January 1, 1998
Last modified: May 8, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again