Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (13 Feb 2019)
Sequence version 2 (27 Jul 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rab GTPase-binding effector protein 1

Gene

Rabep1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Rab effector protein acting as linker between gamma-adaptin, RAB4A and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Involved in KCNH1 channels trafficking to and from the cell membrane. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A. Mediates the traffic of PKD1:PKD2 complex from the endoplasmic reticulum through the Golgi to the cilium (PubMed:25405894).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Endocytosis, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab GTPase-binding effector protein 1
Alternative name(s):
Rabaptin-5
Rabaptin-5alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rabep1
Synonyms:Rab5ep, Rabpt5, Rabpt5a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1860236 Rabep1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Endosome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001875572 – 862Rab GTPase-binding effector protein 1Add BLAST861

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei282N6-acetyllysineBy similarity1
Modified residuei374PhosphoserineBy similarity1
Modified residuei377PhosphoserineBy similarity1
Modified residuei407PhosphoserineCombined sources1
Modified residuei408PhosphothreonineCombined sources1
Modified residuei410PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytic cleavage by caspases in apoptotic cells causes loss of endosome fusion activity.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O35551

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O35551

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O35551

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O35551

PeptideAtlas

More...
PeptideAtlasi
O35551

PRoteomics IDEntifications database

More...
PRIDEi
O35551

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O35551

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O35551

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020817 Expressed in 284 organ(s), highest expression level in adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O35551 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O35551 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with RABGEF1. The heterodimer binds RAB4A and RAB5A that have been activated by GTP-binding. Binds TSC2, GGA2, GGA3, AP1G1 and AP1G2 (By similarity). Interacts with ECPAS (By similarity). Interacts with KCNH1 (PubMed:22841712). Interacts with PKD1 (via C-terminal domain) and GGA1; the interactions recruit PKD1:PKD2 complex to GGA1 and ARL3 at trans-Golgi network (PubMed:25405894). Interacts with KCNH1 (By similarity).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
207592, 5 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O35551

Protein interaction database and analysis system

More...
IntActi
O35551, 6 interactors

Molecular INTeraction database

More...
MINTi
O35551

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000075619

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O35551

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O35551

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili11 – 345Sequence analysisAdd BLAST335
Coiled coili534 – 816Sequence analysisAdd BLAST283

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the rabaptin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0993 Eukaryota
ENOG410XSZ1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063743

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055335

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O35551

KEGG Orthology (KO)

More...
KOi
K12480

Identification of Orthologs from Complete Genome Data

More...
OMAi
LKHTWQR

Database of Orthologous Groups

More...
OrthoDBi
1495285at2759

TreeFam database of animal gene trees

More...
TreeFami
TF329365

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003914 Rabaptin
IPR029880 Rabaptin-5
IPR018514 Rabaptin_coiled-coil
IPR015390 Rabaptin_Rab5-bd_dom

The PANTHER Classification System

More...
PANTHERi
PTHR31179 PTHR31179, 1 hit
PTHR31179:SF5 PTHR31179:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09311 Rab5-bind, 1 hit
PF03528 Rabaptin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01432 RABAPTIN

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O35551-1) [UniParc]FASTAAdd to basket
Also known as: Rabaptin-5

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQPGPAPQP DVSLQQRVAE LEKINAEFLR AQQQLEQEFN QKRAKFKELY
60 70 80 90 100
LAKEEDLKRQ NAVLQAAQDD LGHLRTQLWE AQAEMENIKA IATVSENTKQ
110 120 130 140 150
EAIDEVKRQW REEVASLQAI MKETVRDYEH QFHLRLEQER AQWAQYRESA
160 170 180 190 200
EREIADLRRR LSEGQEEENL ENEMKKAQED AEKLRSVVMP MEKEIAALKD
210 220 230 240 250
KLTEAEDKIK ELEASKVKEL NHYLEAEKSC RTDLEMYVAV LNTQKSVLQE
260 270 280 290 300
DAEKLRKELH EVCHLLEQER QQHNQLKHTW QKANDQFLES QRLLMRDMQR
310 320 330 340 350
MEIVLTSEQL RQVEELKKKD QEEDEQQRVN KRKDNKKTDT EEEVKIPVVC
360 370 380 390 400
ALTQEESSTP LSNEEEHLDS THGSVHSLDA DLMLPSGDPF SKSDNDMFKD
410 420 430 440 450
GLRRAQSTDS LGTSSSLQSK ALGYNYKAKS AGNLDESDFG PLVGADSVSE
460 470 480 490 500
NFDTVSLGSL QMPSGFMLTK DQERAIKAMT PEQEETASLL SSVTQGMESA
510 520 530 540 550
YVSPSGYRLV SETEWNLLQK EVHNAGNKLG RRCDMCSNYE KQLQGIQIQE
560 570 580 590 600
AETRDQVKKL QLMLRQANDQ LEKTMKEKQE LEDFLKQSAE DSSHQISALV
610 620 630 640 650
LRAQASEVLL EELQQSFSQA KRDVQEQMAV LMQSREQVSE ELVRLQKDND
660 670 680 690 700
SLQGKHSLHV SLQLAEDFIL PDTVEVLREL VLKYRENIVH VRTAADHMEE
710 720 730 740 750
KLKAEILFLK EQIQAEQCLK ENLEETLQLE IENCKEEIAS ISSLKAELER
760 770 780 790 800
IKVEKGQLES TLREKSQQLE SLQEMKVNLE EQLKKETAAK ATVEQLMFEE
810 820 830 840 850
KNKAQRLQTE LDVSEQVQRD FVKLSQTLQV QLERIRQADS LERIRAILND
860
TKLTDINQLP ET
Length:862
Mass (Da):99,524
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5796514BB94E7CE5
GO
Isoform 2 (identifier: O35551-2) [UniParc]FASTAAdd to basket
Also known as: Rabaptin-5gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQPGPAPQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKE → MAQPGPAPQPD

Show »
Length:819
Mass (Da):94,348
Checksum:i1EC46FAA8E3FDFF1
GO
Isoform 3 (identifier: O35551-3) [UniParc]FASTAAdd to basket
Also known as: Rabaptin-5delta

The sequence of this isoform differs from the canonical sequence as follows:
     176-215: Missing.

Show »
Length:822
Mass (Da):95,026
Checksum:iAC228D687E2D717B
GO
Isoform 4 (identifier: O35551-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     366-367: EH → VK
     368-862: Missing.

Note: No experimental confirmation available.
Show »
Length:367
Mass (Da):43,381
Checksum:iDEB9F977AE99823E
GO
Isoform 5 (identifier: O35551-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     522-556: Missing.
     831-862: QLERIRQADSLERIRAILNDTKLTDINQLPET → RCLGNHHGPSVGGGTNVAGGLGSPLSLPQIFA

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:827
Mass (Da):94,815
Checksum:iE47F1ACCA58C0134
GO
Isoform 6 (identifier: O35551-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     738-738: I → IVL

Note: No experimental confirmation available.
Show »
Length:864
Mass (Da):99,736
Checksum:i844089C4DF072AC4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QJV7J3QJV7_MOUSE
Rab GTPase-binding effector protein...
Rabep1 mCG_21169
778Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3U983Q3U983_MOUSE
Rab GTPase-binding effector protein...
Rabep1
243Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH03921 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68Q → K in BAB31710 (PubMed:16141072).Curated1
Sequence conflicti805Q → R in BAA23818 (PubMed:9427343).Curated1
Sequence conflicti805Q → R in BAA21783 (PubMed:9427343).Curated1
Sequence conflicti805Q → R in AAF78238 (PubMed:11977240).Curated1
Sequence conflicti805Q → R in AAG44544 (PubMed:11977240).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0104521 – 54MAQPG…YLAKE → MAQPGPAPQPD in isoform 2. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_010453176 – 215Missing in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_010454366 – 367EH → VK in isoform 4. 1 Publication2
Alternative sequenceiVSP_010455368 – 862Missing in isoform 4. 1 PublicationAdd BLAST495
Alternative sequenceiVSP_010456522 – 556Missing in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_025444738I → IVL in isoform 6. 1 Publication1
Alternative sequenceiVSP_010457831 – 862QLERI…QLPET → RCLGNHHGPSVGGGTNVAGG LGSPLSLPQIFA in isoform 5. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D86066 mRNA Translation: BAA21783.1
AB001750 mRNA Translation: BAA23818.1
AF248489 mRNA Translation: AAF78238.1
AF248490 mRNA Translation: AAG44544.1
AL596136 Genomic DNA Translation: CAI26055.1
CR933735, CR936845 Genomic DNA Translation: CAM28155.1
CH466596 Genomic DNA Translation: EDL12625.1
BC129854 mRNA Translation: AAI29855.1
BC003921 mRNA Translation: AAH03921.1 Different initiation.
BC060166 mRNA Translation: AAH60166.1
BC129853 mRNA Translation: AAI29854.1
AK019413 mRNA Translation: BAB31710.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24968.1 [O35551-1]
CCDS70232.1 [O35551-2]
CCDS78984.1 [O35551-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001278070.1, NM_001291141.1 [O35551-2]
NP_001278071.1, NM_001291142.1 [O35551-3]
NP_001278072.1, NM_001291143.1
NP_062273.2, NM_019400.3 [O35551-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.7087

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000076270; ENSMUSP00000075619; ENSMUSG00000020817 [O35551-1]
ENSMUST00000081362; ENSMUSP00000080102; ENSMUSG00000020817 [O35551-3]
ENSMUST00000100928; ENSMUSP00000098488; ENSMUSG00000020817 [O35551-5]
ENSMUST00000108533; ENSMUSP00000104173; ENSMUSG00000020817 [O35551-6]
ENSMUST00000178245; ENSMUSP00000137267; ENSMUSG00000020817 [O35551-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54189

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:54189

UCSC genome browser

More...
UCSCi
uc007jwr.3 mouse [O35551-1]
uc007jwt.3 mouse [O35551-2]
uc007jwu.1 mouse [O35551-5]
uc011xyb.2 mouse [O35551-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D86066 mRNA Translation: BAA21783.1
AB001750 mRNA Translation: BAA23818.1
AF248489 mRNA Translation: AAF78238.1
AF248490 mRNA Translation: AAG44544.1
AL596136 Genomic DNA Translation: CAI26055.1
CR933735, CR936845 Genomic DNA Translation: CAM28155.1
CH466596 Genomic DNA Translation: EDL12625.1
BC129854 mRNA Translation: AAI29855.1
BC003921 mRNA Translation: AAH03921.1 Different initiation.
BC060166 mRNA Translation: AAH60166.1
BC129853 mRNA Translation: AAI29854.1
AK019413 mRNA Translation: BAB31710.3
CCDSiCCDS24968.1 [O35551-1]
CCDS70232.1 [O35551-2]
CCDS78984.1 [O35551-3]
RefSeqiNP_001278070.1, NM_001291141.1 [O35551-2]
NP_001278071.1, NM_001291142.1 [O35551-3]
NP_001278072.1, NM_001291143.1
NP_062273.2, NM_019400.3 [O35551-1]
UniGeneiMm.7087

3D structure databases

ProteinModelPortaliO35551
SMRiO35551
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207592, 5 interactors
CORUMiO35551
IntActiO35551, 6 interactors
MINTiO35551
STRINGi10090.ENSMUSP00000075619

PTM databases

iPTMnetiO35551
PhosphoSitePlusiO35551

Proteomic databases

EPDiO35551
jPOSTiO35551
MaxQBiO35551
PaxDbiO35551
PeptideAtlasiO35551
PRIDEiO35551

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000076270; ENSMUSP00000075619; ENSMUSG00000020817 [O35551-1]
ENSMUST00000081362; ENSMUSP00000080102; ENSMUSG00000020817 [O35551-3]
ENSMUST00000100928; ENSMUSP00000098488; ENSMUSG00000020817 [O35551-5]
ENSMUST00000108533; ENSMUSP00000104173; ENSMUSG00000020817 [O35551-6]
ENSMUST00000178245; ENSMUSP00000137267; ENSMUSG00000020817 [O35551-2]
GeneIDi54189
KEGGimmu:54189
UCSCiuc007jwr.3 mouse [O35551-1]
uc007jwt.3 mouse [O35551-2]
uc007jwu.1 mouse [O35551-5]
uc011xyb.2 mouse [O35551-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9135
MGIiMGI:1860236 Rabep1

Phylogenomic databases

eggNOGiKOG0993 Eukaryota
ENOG410XSZ1 LUCA
GeneTreeiENSGT00530000063743
HOVERGENiHBG055335
InParanoidiO35551
KOiK12480
OMAiLKHTWQR
OrthoDBi1495285at2759
TreeFamiTF329365

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rabep1 mouse

Protein Ontology

More...
PROi
PR:O35551

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020817 Expressed in 284 organ(s), highest expression level in adrenal gland
ExpressionAtlasiO35551 baseline and differential
GenevisibleiO35551 MM

Family and domain databases

InterProiView protein in InterPro
IPR003914 Rabaptin
IPR029880 Rabaptin-5
IPR018514 Rabaptin_coiled-coil
IPR015390 Rabaptin_Rab5-bd_dom
PANTHERiPTHR31179 PTHR31179, 1 hit
PTHR31179:SF5 PTHR31179:SF5, 1 hit
PfamiView protein in Pfam
PF09311 Rab5-bind, 1 hit
PF03528 Rabaptin, 1 hit
PRINTSiPR01432 RABAPTIN

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRABE1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O35551
Secondary accession number(s): A1L322
, Q5QNU3, Q99L08, Q9CRP3, Q9EQF9, Q9JI94
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: July 27, 2011
Last modified: February 13, 2019
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again