Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sulfotransferase family cytosolic 2B member 1

Gene

Sult2b1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids such as dehydroepiandrosterone. Isoform 1 is required for production of cholesterol sulfate essential for normal skin development whereas isoform 2 produces pregnenolone sulfate, an essential neurosteroid during development of the central nervous system. Plays a role in epidermal cholesterol metabolism and in the regulation of epidermal proliferation and differentiation.By similarity

Catalytic activityi

3'-phosphoadenylyl sulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei95SubstrateBy similarity1
Binding sitei100SubstrateBy similarity1
Active sitei122Proton acceptorBy similarity1
Binding sitei144PAPSBy similarity1
Binding sitei152PAPSBy similarity1
Binding sitei207PAPSBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi67 – 72PAPSBy similarity6
Nucleotide bindingi241 – 246PAPSBy similarity6
Nucleotide bindingi271 – 273PAPSBy similarity3

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processLipid metabolism, Steroid metabolism

Enzyme and pathway databases

BRENDAi2.8.2.2 3474
ReactomeiR-MMU-156584 Cytosolic sulfonation of small molecules

Names & Taxonomyi

Protein namesi
Recommended name:
Sulfotransferase family cytosolic 2B member 1 (EC:2.8.2.2)
Short name:
ST2B1
Short name:
Sulfotransferase 2B1
Alternative name(s):
Alcohol sulfotransferase
Hydroxysteroid sulfotransferase 2
Gene namesi
Name:Sult2b1
Synonyms:Sult2b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1926342 Sult2b1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microsome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000851501 – 338Sulfotransferase family cytosolic 2B member 1Add BLAST338

Proteomic databases

EPDiO35400
MaxQBiO35400
PaxDbiO35400
PeptideAtlasiO35400
PRIDEiO35400

PTM databases

iPTMnetiO35400
PhosphoSitePlusiO35400

Expressioni

Tissue specificityi

Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus. Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen. Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate.2 Publications

Developmental stagei

Isoform 1 and isoform 2 are expressed from stages E8.5-E19 embryo.1 Publication

Gene expression databases

BgeeiENSMUSG00000003271 Expressed in 137 organ(s), highest expression level in jejunum
CleanExiMM_SULT2B1
ExpressionAtlasiO35400 baseline and differential
GenevisibleiO35400 MM

Interactioni

Protein-protein interaction databases

IntActiO35400, 7 interactors
MINTiO35400
STRINGi10090.ENSMUSP00000075005

Structurei

3D structure databases

ProteinModelPortaliO35400
SMRiO35400
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the sulfotransferase 1 family.Curated

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00760000118932
HOGENOMiHOG000037209
HOVERGENiHBG001195
InParanoidiO35400
KOiK01015
OMAiRMQGKEN
PhylomeDBiO35400
TreeFamiTF321745

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O35400-1) [UniParc]FASTAAdd to basket
Also known as: SULT2B1b, B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGPQPRALW SSSEKNVSEM SWNFGGEYFR YKGIPFPVGM YSPESLSLAE
60 70 80 90 100
NTSNVRDDDI FIVTYPKSGT NWMIEIVCLI LKDGDPSWIR SEPIWQRAPW
110 120 130 140 150
CETIISAFNV LDRPSPRIMS SHLPIELFTK AFFSSKAKVI YVGRNPRDVV
160 170 180 190 200
VSLYYYSKIA GQLKDPGTPD QFLQNFLKGE VQFGSWFDHI KGWIRMQNQE
210 220 230 240 250
NFLFITYEEL QQDLRGSVQR ICEFLGRPLG EEALSSVVAH SAFAAMKANT
260 270 280 290 300
MSNYSLLPAS LLDHRQGEFL RKGISGDWKN HFTVAQSEAF DSVYREQMHG
310 320 330
VQRFPWDTSE EDSSPDGQPD PEPSPSPASD DPNPGSSQ
Length:338
Mass (Da):38,347
Last modified:January 4, 2005 - v2
Checksum:iEA21BAB0917034C1
GO
Isoform 2 (identifier: O35400-2) [UniParc]FASTAAdd to basket
Also known as: SULT2B1a, A

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MDGPQPRALWSSSEKNVSEM → MTSRDCCCGGVEVDLLLRWTHGAQRKDTPHWRVNEGPCDSCPPPWSSLHVPFPSF

Note: No experimental confirmation available.
Show »
Length:373
Mass (Da):42,308
Checksum:i8C4B1076532EFD4C
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GST5A0A1B0GST5_MOUSE
Sulfotransferase
Sult2b1
372Annotation score:
A0A1B0GRK8A0A1B0GRK8_MOUSE
Sulfotransferase
Sult2b1
130Annotation score:
A0A1B0GR49A0A1B0GR49_MOUSE
Sulfotransferase
Sult2b1
370Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti329S → F in AAC69918 (PubMed:9647753).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0125111 – 20MDGPQ…NVSEM → MTSRDCCCGGVEVDLLLRWT HGAQRKDTPHWRVNEGPCDS CPPPWSSLHVPFPSF in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026072 mRNA Translation: AAC69918.1
AF478566 mRNA Translation: AAM46788.1
BC009811 mRNA Translation: AAH09811.1
BC009813 mRNA Translation: AAH09813.1
CCDSiCCDS21263.1 [O35400-1]
PIRiJE0196
RefSeqiNP_059493.2, NM_017465.2 [O35400-1]
UniGeneiMm.271634

Genome annotation databases

EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271 [O35400-1]
GeneIDi54200
KEGGimmu:54200
UCSCiuc009gxb.2 mouse [O35400-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026072 mRNA Translation: AAC69918.1
AF478566 mRNA Translation: AAM46788.1
BC009811 mRNA Translation: AAH09811.1
BC009813 mRNA Translation: AAH09813.1
CCDSiCCDS21263.1 [O35400-1]
PIRiJE0196
RefSeqiNP_059493.2, NM_017465.2 [O35400-1]
UniGeneiMm.271634

3D structure databases

ProteinModelPortaliO35400
SMRiO35400
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35400, 7 interactors
MINTiO35400
STRINGi10090.ENSMUSP00000075005

PTM databases

iPTMnetiO35400
PhosphoSitePlusiO35400

Proteomic databases

EPDiO35400
MaxQBiO35400
PaxDbiO35400
PeptideAtlasiO35400
PRIDEiO35400

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075571; ENSMUSP00000075005; ENSMUSG00000003271 [O35400-1]
GeneIDi54200
KEGGimmu:54200
UCSCiuc009gxb.2 mouse [O35400-1]

Organism-specific databases

CTDi6820
MGIiMGI:1926342 Sult2b1

Phylogenomic databases

eggNOGiKOG1584 Eukaryota
ENOG4111H56 LUCA
GeneTreeiENSGT00760000118932
HOGENOMiHOG000037209
HOVERGENiHBG001195
InParanoidiO35400
KOiK01015
OMAiRMQGKEN
PhylomeDBiO35400
TreeFamiTF321745

Enzyme and pathway databases

BRENDAi2.8.2.2 3474
ReactomeiR-MMU-156584 Cytosolic sulfonation of small molecules

Miscellaneous databases

PROiPR:O35400
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000003271 Expressed in 137 organ(s), highest expression level in jejunum
CleanExiMM_SULT2B1
ExpressionAtlasiO35400 baseline and differential
GenevisibleiO35400 MM

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR000863 Sulfotransferase_dom
PfamiView protein in Pfam
PF00685 Sulfotransfer_1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiST2B1_MOUSE
AccessioniPrimary (citable) accession number: O35400
Secondary accession number(s): Q8K472, Q91V03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 4, 2005
Last sequence update: January 4, 2005
Last modified: November 7, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again