UniProtKB - O35387 (HAX1_MOUSE)

BLAST

>sp|O35387|HAX1_MOUSE HCLS1-associated protein X-1 OS=Mus musculus OX=10090 GN=Hax1 PE=1 SV=1
MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQP
PEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERL
REGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHS
RAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETT
VTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR

Align
Format
Add to basket Added to basket
History
Entry version 149 (07 Nov 2018)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

HCLS1-associated protein X-1

Gene

Hax1

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Recruits the Arp2/3 complex to the cell cortex and regulates reorganization of the cortical actin cytoskeleton via its interaction with KCNC3 and the Arp2/3 complex. Slows down the rate of inactivation of KCNC3 channels. Promotes GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. Promotes cell survival. May regulate intracellular calcium pools.By similarity

GO - Molecular functionⁱ

interleukin-1 binding Source: MGI
protein domain specific binding Source: MGI
protein N-terminus binding Source: MGI

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell surface receptor signaling pathway
Source: MGI
Traceable author statementⁱ
- 9058808
cellular response to cytokine stimulus Source: MGI
negative regulation of apoptotic process Source: MGI
positive regulation of actin cytoskeleton reorganization Source: MGI
positive regulation of granulocyte differentiation Source: MGI
positive regulation of peptidyl-serine phosphorylation Source: MGI
positive regulation of peptidyl-tyrosine phosphorylation Source: MGI
positive regulation of phosphatidylinositol 3-kinase signaling Source: MGI
positive regulation of protein kinase B signaling Source: MGI
positive regulation of transcription by RNA polymerase II Source: MGI
regulation of actin filament polymerization Source: MGI

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: HCLS1-associated protein X-1 Alternative name(s): HS1-associating protein X-1 Short name: HAX-1 HS1-binding protein 1 Short name: HSP1BP-1
Gene namesⁱ	Name:Hax1 Synonyms:Hs1bp1
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 3

Organism-specific databases

MGIⁱ	MGI:1346319 Hax1

Keywords - Cellular componentⁱ

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Membrane, Mitochondrion, Nucleus, Sarcoplasmic reticulum

Pathology & Biotechⁱ

Disruption phenotypeⁱ

Mice lacking Hax1 fail to survive longer than 14 weeks, due to a loss of motor coordination and activity, leading to failure to eat and drink. They display extensive apoptosis of neurons in the striatum and cerebellum, and a loss of lymphocytes in spleen, bone marrow and thymus.1 Publication

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedBy similarity
ChainⁱPRO_0000083907	2 – 280	HCLS1-associated protein X-1Add BLAST		279

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylserineBy similarity	1
Modified residueⁱ	190	PhosphoserineBy similarity	1
Modified residueⁱ	193	PhosphoserineBy similarity	1

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Siteⁱ	128 – 129	Cleavage; by caspase-3By similarity		2

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	O35387
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	O35387
PaxDbⁱ	O35387
PRIDEⁱ	O35387

PTM databases

iPTMnetⁱ	O35387
PhosphoSitePlusⁱ	O35387

Expressionⁱ

Tissue specificityⁱ

Ubiquitous, with highest levels in kidney and liver (at protein level).1 Publication

Gene expression databases

Bgeeⁱ	ENSMUSG00000027944 Expressed in 21 organ(s), highest expression level in female gonad
CleanExⁱ	MM_HAX1
ExpressionAtlasⁱ	O35387 baseline and differential
Genevisibleⁱ	O35387 MM

Interactionⁱ

Subunit structureⁱ

Interacts with ABCB1, ABCB4 and ABCB11 (By similarity). Directly associates with HCLS1/HS1, through binding to its N-terminal region (By similarity). Interacts with CTTN (PubMed:10760273). Interacts with PKD2(PubMed:10760273). Interacts with GNA13. Interacts with CASP9. Interacts with ITGB6. Interacts with PLN and ATP2A2; these interactions are inhibited by calcium. Interacts with GRB7. Interacts (via C-terminus) with XIAP/BIRC4 (via BIR 2 domain and BIR 3 domain) and this interaction blocks ubiquitination of XIAP/BIRC4. Interacts with TPC2. Interacts with KCNC3 (PubMed:26997484). Interacts with XPO1 (By similarity).By similarity1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
Arrb1	Q8BWG8	6	EBI-642449,EBI-641778
Htra2	Q9JIY5	3	EBI-642449,EBI-2365838
PKD2	Q13563	3	EBI-642449,EBI-7813714	From Homo sapiens.
Stat3	P42227	11	EBI-642449,EBI-602878

GO - Molecular functionⁱ

interleukin-1 binding Source: MGI
protein domain specific binding Source: MGI
protein N-terminus binding Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	204783, 16 interactors
CORUMⁱ	O35387
Database of interacting proteins More...DIPⁱ	DIP-49445N
IntActⁱ	O35387, 21 interactors
STRINGⁱ	10090.ENSMUSP00000078661

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	O35387
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	2 – 45	Required for localization in mitochondriaBy similarityAdd BLAST	44
Regionⁱ	115 – 280	Involved in HCLS1 bindingBy similarityAdd BLAST	166
Regionⁱ	176 – 207	Involved in CASP9 bindingBy similarityAdd BLAST	32
Regionⁱ	177 – 248	Involved in GNA13 bindingBy similarityAdd BLAST	72
Regionⁱ	184 – 280	Required for localization in sarcoplasmic reticulumBy similarityAdd BLAST	97
Regionⁱ	185 – 280	Involved in PKD2 bindingAdd BLAST	96
Regionⁱ	204 – 246	Involved in ATP2A2 bindingBy similarityAdd BLAST	43
Regionⁱ	204 – 226	Involved in PLN bindingBy similarityAdd BLAST	23
Regionⁱ	271 – 280	Required for ITGB6 bindingBy similarity	10

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	30 – 44	Asp/Glu-rich (highly acidic)Add BLAST		15

Sequence similaritiesⁱ

Belongs to the HAX1 family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410IJQ0 Eukaryota ENOG411211U LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000018324
HOGENOMⁱ	HOG000090247
HOVERGENⁱ	HBG002991
InParanoidⁱ	O35387
KEGG Orthology (KO) More...KOⁱ	K16220
OMAⁱ	GSQRPFH
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0MK9
PhylomeDBⁱ	O35387
TreeFamⁱ	TF328619

Family and domain databases

InterProⁱ	View protein in InterPro IPR017248 HAX-1
PANTHERⁱ	PTHR14938 PTHR14938, 1 hit
PIRSFⁱ	PIRSF037634 HS1-associating_X-1, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 7 potential isoforms that are computationally mapped.Show all Align All

O35387-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSVFDLFRGF FGFPGPRSHR DPFFGGMTRD DDDDDDDDDE AEEDRGAWGR 
        60         70         80         90        100
ESYAFDGSQP PEEFGFSFSP RGGMRFHGNF GFDDLVRDFN SIFSEMGAWT 
       110        120        130        140        150
LPSHSPELPG PESETPGERL REGQTLRDSM LKYPDSHQPR IFEGVLESHA 
       160        170        180        190        200
KPESPKPAPD WGSQGPFHRL DDTWPVSPHS RAKEDKDLDS QVSQEGLGPL 
       210        220        230        240        250
LQPQPKSYFK SISVTKITKP DGTVEERRTV VDSEGRRETT VTHQEAHDSS 
       260        270        280
RSDPDSQRSS ALDDPFSILD LLLGRWFRSR

Length:280

Mass (Da):31,654

Last modified:January 1, 1998 - v1

Checksum:ⁱ3123979BA10B45D1

Computationally mapped potential isoform sequencesⁱ

There are 7 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A0G2JDP0	A0A0G2JDP0_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1 (HS1-associating protein X-1)	Hax1	277	Annotation score:
A0A0G2JFF9	A0A0G2JFF9_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1 (HS1-associating protein X-1)	Hax1	254	Annotation score:
A0A0G2JE46	A0A0G2JE46_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1 (HS1-associating protein X-1)	Hax1 mCG_124547	196	Annotation score:
A0A0G2JGG5	A0A0G2JGG5_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1	Hax1	69	Annotation score:
A0A0G2JEE6	A0A0G2JEE6_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1	Hax1	151	Annotation score:
A0A0G2JFE1	A0A0G2JFE1_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1	Hax1	66	Annotation score:
A0A0G2JGR0	A0A0G2JGR0_MOUSE	HCLS1-associated protein X-1 HCLS1-associated protein X-1	Hax1	36	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF023482 mRNA Translation: AAB81081.1 AK002256 mRNA Translation: BAB21969.1 AK010633 mRNA Translation: BAB27077.1 AK088746 mRNA Translation: BAC40544.1 BC006688 mRNA Translation: AAH06688.1 BC098225 mRNA Translation: AAH98225.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS17519.1
NCBI Reference Sequences More...RefSeqⁱ	NP_035956.1, NM_011826.4
UniGeneⁱ	Mm.256035 Mm.416677

Genome annotation databases

Ensemblⁱ	ENSMUST00000079724; ENSMUSP00000078661; ENSMUSG00000027944
GeneIDⁱ	23897
KEGGⁱ	mmu:23897
UCSC genome browser More...UCSCⁱ	uc008qaj.2 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
O35387	HCLS1-associated protein X-1		MOUSE		280	UniRef100_O35387
HCLS1-associated protein X-1		MOUSE		151
HCLS1-associated protein X-1 (Fragment)		MOUSE		69
HCLS1-associated protein X-1		MOUSE		254

Protein	Similar proteins		Species	Score	Length	Source
O35387	HCLS1-associated protein X-1		RAT		278	UniRef90_O35387
HCLS1-associated protein X-1		MOUSE		280
UPI000A316841		MUSCR		284
UPI000A30457D		MUSPA		279
HCLS1-associated protein X-1		MOUSE		151
+9

Protein	Similar proteins		Species	Score	Length	Source
O35387	Isoform 2 of HCLS1-associated protein X-1		HUMAN		287	UniRef50_O00165-2
HCLS1-associated protein X-1		BOVIN		279
HCLS1-associated protein X-1		RAT		278
Uncharacterized protein		PAPAN		287
Uncharacterized protein		MANLE		287
+178

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF023482 mRNA Translation: AAB81081.1 AK002256 mRNA Translation: BAB21969.1 AK010633 mRNA Translation: BAB27077.1 AK088746 mRNA Translation: BAC40544.1 BC006688 mRNA Translation: AAH06688.1 BC098225 mRNA Translation: AAH98225.1
CCDSⁱ	CCDS17519.1
RefSeqⁱ	NP_035956.1, NM_011826.4
UniGeneⁱ	Mm.256035 Mm.416677

3D structure databases

ProteinModelPortalⁱ	O35387
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	204783, 16 interactors
CORUMⁱ	O35387
DIPⁱ	DIP-49445N
IntActⁱ	O35387, 21 interactors
STRINGⁱ	10090.ENSMUSP00000078661

PTM databases

iPTMnetⁱ	O35387
PhosphoSitePlusⁱ	O35387

Proteomic databases

EPDⁱ	O35387
MaxQBⁱ	O35387
PaxDbⁱ	O35387
PRIDEⁱ	O35387

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000079724; ENSMUSP00000078661; ENSMUSG00000027944
GeneIDⁱ	23897
KEGGⁱ	mmu:23897
UCSCⁱ	uc008qaj.2 mouse

Organism-specific databases

CTDⁱ	10456
MGIⁱ	MGI:1346319 Hax1

Phylogenomic databases

eggNOGⁱ	ENOG410IJQ0 Eukaryota ENOG411211U LUCA
GeneTreeⁱ	ENSGT00390000018324
HOGENOMⁱ	HOG000090247
HOVERGENⁱ	HBG002991
InParanoidⁱ	O35387
KOⁱ	K16220
OMAⁱ	GSQRPFH
OrthoDBⁱ	EOG091G0MK9
PhylomeDBⁱ	O35387
TreeFamⁱ	TF328619

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:O35387
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000027944 Expressed in 21 organ(s), highest expression level in female gonad
CleanExⁱ	MM_HAX1
ExpressionAtlasⁱ	O35387 baseline and differential
Genevisibleⁱ	O35387 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR017248 HAX-1
PANTHERⁱ	PTHR14938 PTHR14938, 1 hit
PIRSFⁱ	PIRSF037634 HS1-associating_X-1, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	HAX1_MOUSE
Accessionⁱ	O35387Primary (citable) accession number: O35387 Secondary accession number(s): Q542F8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 15, 1998
	Last sequence update:	January 1, 1998
	Last modified:	November 7, 2018
	This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - O35387 (HAX1_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

HCLS1-associated protein X-1

Hax1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Plasma membrane

Mitochondrion

Endoplasmic reticulum

Other locations

Cytoskeleton

Endoplasmic reticulum

Mitochondrion

Nucleus

Plasma Membrane

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Sites

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ