Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interferon-activable protein 203

Gene

Ifi203

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • activation of innate immune response Source: InterPro
  • cellular response to interferon-beta Source: MGI

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interferon-activable protein 203
Short name:
Ifi-203
Alternative name(s):
Interferon-inducible protein p203
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ifi203
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:96428 Ifi203

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001537201 – 408Interferon-activable protein 203Add BLAST408

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O35368

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O35368

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O35368

PRoteomics IDEntifications database

More...
PRIDEi
O35368

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O35368

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O35368

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Constitutively expressed in the thymus, bone marrow and spleen. Isoform 1 and isoform 3 are present in liver (at protein level).1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 1 and isoform 3 are induced by alpha interferon (at protein level).1 Publication

Gene expression databases

CleanEx database of gene expression profiles

More...
CleanExi
MM_IFI203

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
O35368, 2 interactors

Molecular INTeraction database

More...
MINTi
O35368

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O35368

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O35368

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 87PyrinPROSITE-ProRule annotationAdd BLAST87
Domaini190 – 388HIN-200PROSITE-ProRule annotationAdd BLAST199

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi141 – 144Poly-Lys4
Compositional biasi178 – 182Poly-Ser5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the HIN-200 family.Curated

Phylogenomic databases

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006122

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O35368

Database of Orthologous Groups

More...
OrthoDBi
1304994at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O35368

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR040205 HIN-200
IPR004021 HIN200/IF120x

The PANTHER Classification System

More...
PANTHERi
PTHR12200 PTHR12200, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02760 HIN, 1 hit
PF02758 PYRIN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01289 PYRIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50824 DAPIN, 1 hit
PS50834 HIN_200, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O35368-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEYKNIVLL KGLENMEDYQ FRTVKSLLRK ELKLTKKMQE DYDRIQLADW
60 70 80 90 100
MEDKFPKDAG LDKLIKVCEH IKDLKDLAKK LKTEKAKVQE KKKGKCKTAG
110 120 130 140 150
KKKGQDELSS SESLFINKES YKSVPSSKKK RKQITKTEGG KKKKLTQEQA
160 170 180 190 200
QLPETSGTNI KKEEDCLQNP HKSPPTPSSS SSNKAPRRGT VPKEPSREEG
210 220 230 240 250
HHQGPKQVMV LKVTEPFTYD FEETKRMFHA TVATETEFFR VKVFDTALMS
260 270 280 290 300
KFIPGKIIAI SHYIGCNGFL EIYRASCVSD VNINPTMIIS NTLSESAIAT
310 320 330 340 350
PKISYLLSQA KGTFVNGEFV VFKKSERHEC ICYGIGDDTG KMAVVVYGRL
360 370 380 390 400
TNVRCEPGSK LRLVCFELTS TKDVCLLRSV RHSYMQVINE GKPLNPDSVR

RNSLEPYF
Length:408
Mass (Da):46,300
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3BA0E01834D9E5A9
GO
Isoform 2 (identifier: O35368-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-191: APRRGTV → VTLSYPQ
     192-408: Missing.

Note: No experimental confirmation available.
Show »
Length:191
Mass (Da):21,865
Checksum:i115098D54CD688BE
GO
Isoform 3 (identifier: O35368-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-183: N → NKKNPVVASFLLASRASTSGAKTREQDILRHKQRPSRKGGFKTTFCERI

Show »
Length:456
Mass (Da):51,685
Checksum:iFBC5ED3B4912771C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QAN9E9QAN9_MOUSE
Interferon-activable protein 203
Ifi203
871Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PUG6E9PUG6_MOUSE
Interferon-activable protein 203
Ifi203
409Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0H6A0A0R4J0H6_MOUSE
Interferon-activable protein 203
Ifi203
457Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAE25996 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti51M → I in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti51M → I in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti90E → K in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti90E → K in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti93K → E in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti93K → E in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti98T → M in BAE41346 (PubMed:16141072).Curated1
Sequence conflicti116I → N in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti116I → N in BAC30542 (PubMed:16141072).Curated1
Sequence conflicti121Y → N in BAE25996 (PubMed:16141072).Curated1
Sequence conflicti121Y → N in BAC30542 (PubMed:16141072).Curated1
Isoform 3 (identifier: O35368-3)
Sequence conflicti197R → Q in AAH08167 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033652183N → NKKNPVVASFLLASRASTSG AKTREQDILRHKQRPSRKGG FKTTFCERI in isoform 3. 2 Publications1
Alternative sequenceiVSP_033653185 – 191APRRGTV → VTLSYPQ in isoform 2. 1 Publication7
Alternative sequenceiVSP_033654192 – 408Missing in isoform 2. 1 PublicationAdd BLAST217

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF022371 mRNA Translation: AAC53428.1
AK040214 mRNA Translation: BAC30542.1
AK144663 mRNA Translation: BAE25996.1 Different initiation.
AK164695 mRNA Translation: BAE37880.1
AK169754 mRNA Translation: BAE41346.1
AK172505 mRNA Translation: BAE43039.1
BC008167 mRNA Translation: AAH08167.1

NCBI Reference Sequences

More...
RefSeqi
NP_001289578.1, NM_001302649.1
NP_001289579.1, NM_001302650.1
NP_001289580.1, NM_001302651.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.463437
Mm.472787

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
15950

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:15950

UCSC genome browser

More...
UCSCi
uc007dsj.1 mouse [O35368-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF022371 mRNA Translation: AAC53428.1
AK040214 mRNA Translation: BAC30542.1
AK144663 mRNA Translation: BAE25996.1 Different initiation.
AK164695 mRNA Translation: BAE37880.1
AK169754 mRNA Translation: BAE41346.1
AK172505 mRNA Translation: BAE43039.1
BC008167 mRNA Translation: AAH08167.1
RefSeqiNP_001289578.1, NM_001302649.1
NP_001289579.1, NM_001302650.1
NP_001289580.1, NM_001302651.1
UniGeneiMm.463437
Mm.472787

3D structure databases

ProteinModelPortaliO35368
SMRiO35368
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35368, 2 interactors
MINTiO35368

PTM databases

iPTMnetiO35368
PhosphoSitePlusiO35368

Proteomic databases

EPDiO35368
jPOSTiO35368
MaxQBiO35368
PRIDEiO35368

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi15950
KEGGimmu:15950
UCSCiuc007dsj.1 mouse [O35368-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
15950
MGIiMGI:96428 Ifi203

Phylogenomic databases

HOVERGENiHBG006122
InParanoidiO35368
OrthoDBi1304994at2759
PhylomeDBiO35368

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ifi203 mouse

Protein Ontology

More...
PROi
PR:O35368

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

CleanExiMM_IFI203

Family and domain databases

InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR040205 HIN-200
IPR004021 HIN200/IF120x
PANTHERiPTHR12200 PTHR12200, 1 hit
PfamiView protein in Pfam
PF02760 HIN, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS50834 HIN_200, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIFI3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O35368
Secondary accession number(s): Q3T9I1
, Q3TEA2, Q3TP57, Q3UMV2, Q8BYE5, Q91VV8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again