Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - O35136 (NCAM2_MOUSE)

Entry version 176 (29 Sep 2021)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Neural cell adhesion molecule 2

Gene

Ncam2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
Alternative name(s):
Neural cell adhesion molecule RB-8
R4B12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ncam2
Synonyms:Ocam, Rncam
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:97282, Ncam2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000022762

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 697ExtracellularSequence analysisAdd BLAST678
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 837CytoplasmicSequence analysisAdd BLAST119

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004258920 – 837Neural cell adhesion molecule 2Add BLAST818

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi232 ↔ 281Curated
Glycosylationi309N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi322 ↔ 380Curated
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi419N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi422 ↔ 475Curated
Glycosylationi445N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi474N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi562N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei765PhosphoserineCombined sources1
Modified residuei780PhosphothreonineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Isoform Short (identifier: O35136-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi703GPI-anchor amidated asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		O35136

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O35136

PeptideAtlas

More...PeptideAtlasi		O35136

PRoteomics IDEntifications database

More...PRIDEi		O35136

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		287449 [O35136-1]
287450 [O35136-2]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		2536, 11 N-Linked glycans (4 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O35136, 8 sites, 11 N-linked glycans (4 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O35136

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O35136

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O35136

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in subsets of both olfactory and vomeronasal neurons in a zone-specific manner.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000022762, Expressed in midbrain and 168 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O35136, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201700, 7 interactors

Protein interaction database and analysis system

More...IntActi		O35136, 2 interactors

Molecular INTeraction database

More...MINTi		O35136

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000063468

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O35136, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O35136

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 108Ig-like C2-type 1Add BLAST88
Domaini113 – 202Ig-like C2-type 2Add BLAST90
Domaini208 – 297Ig-like C2-type 3Add BLAST90
Domaini302 – 396Ig-like C2-type 4Add BLAST95
Domaini401 – 491Ig-like C2-type 5Add BLAST91
Domaini495 – 591Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST97
Domaini593 – 688Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni764 – 810DisorderedSequence analysisAdd BLAST47

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi764 – 784Basic and acidic residuesSequence analysisAdd BLAST21

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3510, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157860

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_010961_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O35136

Identification of Orthologs from Complete Genome Data

More...OMAi		CEANKGE

Database for complete collections of gene phylogenies

More...PhylomeDBi		O35136

TreeFam database of animal gene trees

More...TreeFami		TF326195

Family and domain databases

Conserved Domains Database

More...CDDi		cd00063, FN3, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 7 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR009138, Neural_cell_adh

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00041, fn3, 2 hits
PF07679, I-set, 4 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01838, NCAMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00060, FN3, 2 hits
SM00409, IG, 5 hits
SM00408, IGc2, 5 hits
SM00406, IGv, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 5 hits
SSF49265, SSF49265, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50853, FN3, 2 hits
PS50835, IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform Long (identifier: O35136-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLLLSFYLL GLLVRSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES 
        60         70         80         90        100
IDWYNPQGEK IISTQRVMLQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG 
       110        120        130        140        150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY 
       160        170        180        190        200
HNEEVTTIPD NRFAVLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD 
       210        220        230        240        250
IIVIVNVPPA IMMPQKSFNA TAERGEEMTL TCKASGSPDP TISWFRNGKL 
       260        270        280        290        300
IEENEKYILK GSNTELTVRN IINKDGGSYV CKATNKAGED QKQAFLQVFV 
       310        320        330        340        350
QPHILQLKNE TTSENGHVTL VCEAEGEPVP EITWKRAIDG VMFSEGDKSP 
       360        370        380        390        400
DGRIEVKGQH GRSSLHIRDV KLSDSGRYDC EAASRIGGHQ RSMHLDIEYA 
       410        420        430        440        450
PKFVSNQTMY YSWEGNPINI SCDVTANPPA SIHWRREKLL LPAKNTTHLK 
       460        470        480        490        500
THSVGRKMIL EIAPTSDNDF GRYNCTATNR IGTRFQEYIL ELADVPSSPH 
       510        520        530        540        550
GVKIIELSQT TAKISFNKPE SHGGVPIHHY QVDVKEVASE TWKIVRSHGV 
       560        570        580        590        600
QTMVVLSSLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH 
       610        620        630        640        650
GQPSSGKSFK ISITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH 
       660        670        680        690        700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG 
       710        720        730        740        750
LGAIIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS 
       760        770        780        790        800
KELEEGKAAY LKDGSKEPIV EMRTEDERIT NHEDGSPVNE PNETTPLTEP 
       810        820        830 
EKLPLKEENG KEVLNAETIE IKVSNDIIQS KEDDIKA
Length:837
Mass (Da):93,204
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i70473B053A2D65A5
GO
Isoform Short (identifier: O35136-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     694-837: TLFNGLGLGA...IQSKEDDIKA → NCCEANKGENGGQSWHLNAVGFTFVITMSLSCLF

Show »
Length:727
Mass (Da):81,208
Checksum:iBAE4590B330516C8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002590694 – 837TLFNG…DDIKA → NCCEANKGENGGQSWHLNAV GFTFVITMSLSCLF in isoform Short. 3 PublicationsAdd BLAST144

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF001287 mRNA Translation: AAB69125.1
AF001286 mRNA Translation: AAB69124.1
AF016619 mRNA Translation: AAC53375.1
BC119027 mRNA Translation: AAI19028.1
BC119029 mRNA Translation: AAI19030.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS28281.1 [O35136-2]
CCDS49888.1 [O35136-1]

NCBI Reference Sequences

More...RefSeqi		NP_001106679.1, NM_001113208.1 [O35136-1]
NP_035084.1, NM_010954.4 [O35136-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762 [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762 [O35136-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17968

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17968

UCSC genome browser

More...UCSCi		uc007zta.2, mouse [O35136-2]
uc007ztb.2, mouse [O35136-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF001287 mRNA Translation: AAB69125.1
AF001286 mRNA Translation: AAB69124.1
AF016619 mRNA Translation: AAC53375.1
BC119027 mRNA Translation: AAI19028.1
BC119029 mRNA Translation: AAI19030.1
CCDSiCCDS28281.1 [O35136-2]
CCDS49888.1 [O35136-1]
RefSeqiNP_001106679.1, NM_001113208.1 [O35136-1]
NP_035084.1, NM_010954.4 [O35136-2]

3D structure databases

SMRiO35136
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi201700, 7 interactors
IntActiO35136, 2 interactors
MINTiO35136
STRINGi10090.ENSMUSP00000063468

PTM databases

GlyConnecti2536, 11 N-Linked glycans (4 sites)
GlyGeniO35136, 8 sites, 11 N-linked glycans (4 sites)
iPTMnetiO35136
PhosphoSitePlusiO35136
SwissPalmiO35136

Proteomic databases

MaxQBiO35136
PaxDbiO35136
PeptideAtlasiO35136
PRIDEiO35136
ProteomicsDBi287449 [O35136-1]
287450 [O35136-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		22282, 308 antibodies

The DNASU plasmid repository

More...DNASUi		17968

Genome annotation databases

EnsembliENSMUST00000037785; ENSMUSP00000049390; ENSMUSG00000022762 [O35136-2]
ENSMUST00000067602; ENSMUSP00000063468; ENSMUSG00000022762 [O35136-1]
GeneIDi17968
KEGGimmu:17968
UCSCiuc007zta.2, mouse [O35136-2]
uc007ztb.2, mouse [O35136-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4685
MGIiMGI:97282, Ncam2
VEuPathDBiHostDB:ENSMUSG00000022762

Phylogenomic databases

eggNOGiKOG3510, Eukaryota
GeneTreeiENSGT00940000157860
HOGENOMiCLU_010961_1_0_1
InParanoidiO35136
OMAiCEANKGE
PhylomeDBiO35136
TreeFamiTF326195

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17968, 2 hits in 64 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Ncam2, mouse

Protein Ontology

More...PROi		PR:O35136
RNActiO35136, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000022762, Expressed in midbrain and 168 other tissues
GenevisibleiO35136, MM

Family and domain databases

CDDicd00063, FN3, 2 hits
Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR009138, Neural_cell_adh
PfamiView protein in Pfam
PF00041, fn3, 2 hits
PF07679, I-set, 4 hits
PRINTSiPR01838, NCAMFAMILY
SMARTiView protein in SMART
SM00060, FN3, 2 hits
SM00409, IG, 5 hits
SM00408, IGc2, 5 hits
SM00406, IGv, 3 hits
SUPFAMiSSF48726, SSF48726, 5 hits
SSF49265, SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853, FN3, 2 hits
PS50835, IG_LIKE, 5 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCAM2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O35136
Secondary accession number(s): O35962, Q0VF23
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: September 29, 2021
This is version 176 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again