Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dihydropyrimidinase-related protein 4

Gene

Dpysl4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).By similarity

Caution

Lacks most of the conserved residues that are essential for binding the metal cofactor and hence for dihydropyrimidinase activity. Its enzyme activity is therefore unsure.Curated

GO - Molecular functioni

GO - Biological processi

Protein family/group databases

MEROPSiM38.977

Names & Taxonomyi

Protein namesi
Recommended name:
Dihydropyrimidinase-related protein 4
Short name:
DRP-4
Alternative name(s):
Collapsin response mediator protein 3
Short name:
CRMP-3
UNC33-like phosphoprotein 4
Short name:
ULIP-4
Gene namesi
Name:Dpysl4
Synonyms:Crmp3, Ulip4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1349764 Dpysl4

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001659221 – 572Dihydropyrimidinase-related protein 4Add BLAST572

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei537PhosphoserineCombined sources1
Modified residuei544PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiO35098
PaxDbiO35098
PeptideAtlasiO35098
PRIDEiO35098

2D gel databases

REPRODUCTION-2DPAGEiO35098

PTM databases

iPTMnetiO35098
PhosphoSitePlusiO35098
SwissPalmiO35098

Expressioni

Gene expression databases

CleanExiMM_DPYSL4

Interactioni

Subunit structurei

Homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL3 or DPYSL5. Interacts with PLEXA1.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

IntActiO35098, 3 interactors
MINTiO35098
STRINGi10090.ENSMUSP00000026551

Structurei

3D structure databases

ProteinModelPortaliO35098
SMRiO35098
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2584 Eukaryota
COG0044 LUCA
HOGENOMiHOG000219145
HOVERGENiHBG000806
InParanoidiO35098
PhylomeDBiO35098

Family and domain databases

CDDicd01314 D-HYD, 1 hit
Gene3Di2.30.40.10, 1 hit
InterProiView protein in InterPro
IPR006680 Amidohydro-rel
IPR030612 DRP4
IPR011778 Hydantoinase/dihydroPyrase
IPR011059 Metal-dep_hydrolase_composite
IPR032466 Metal_Hydrolase
PANTHERiPTHR11647:SF55 PTHR11647:SF55, 1 hit
PfamiView protein in Pfam
PF01979 Amidohydro_1, 1 hit
SUPFAMiSSF51338 SSF51338, 2 hits
SSF51556 SSF51556, 1 hit
TIGRFAMsiTIGR02033 D-hydantoinase, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O35098-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSFQGKKSIP RITSDRLLIK GGKIVNDDQS FHADLYVEDG LIKQIGENLI
60 70 80 90 100
VPGGIKTIDA HGLMVLPGGV DVHTRLQMPV MGMTPADDFC QGTKAALAGG
110 120 130 140 150
TTMILDHVFP DAGVSLLAAY EQWRERADSA ACCDYSLHVD IPRWHESTKE
160 170 180 190 200
ELEALVRDKG VNSFLVFMAY KDRCQCTDGQ IYEIFSLIRD LGAVAQVHAE
210 220 230 240 250
NGDIVEEEQK RLLEQGITGP EGHVLSHPEE VEAEAVYRAV TIAKQANCPL
260 270 280 290 300
YVTKVMSKGA ADMVAQAKRR GVVVFGEPIT ASLGTDGSHY WSKNWAKAAA
310 320 330 340 350
FVTSPPINPD PTTADHLTSL LSSGDLQVTG SAHCTFTTAQ KAVGKDNFTL
360 370 380 390 400
IPEGVNGIEE RMSVVWEKCV ASGKMDENEF VAVTSTNAAK IFNFYPRKGR
410 420 430 440 450
VAVGSDADLV IWNPRATKVF SAKSHNLNVE YNIFEGVECR GVPTVVISQG
460 470 480 490 500
RVVLEDGNLL VTPGAGRFIP RKTFPDFVYK RIKARNRLAE IHGVPRGLYD
510 520 530 540 550
GPVHEVMLPA KPGSGTQARA SCSGKISVPP VRNLHQSGFS LSGSQADDHI
560 570
ARRTAQKIMA PPGGRSNITS LS
Length:572
Mass (Da):61,962
Last modified:January 1, 1998 - v1
Checksum:i37671129FC02C7AF
GO
Isoform 2 (identifier: O35098-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MSFQGKKSIPRIT → MAYKMSQSISVTLGKDIPSRLRCLPQRPLFSLCQ

Note: No experimental confirmation available.
Show »
Length:593
Mass (Da):64,337
Checksum:iF2DE068919E8328C
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3TMU8Q3TMU8_MOUSE
Dihydropyrimidinase-like 4
Dpysl4
572Annotation score:
A0A0R4J1N0A0A0R4J1N0_MOUSE
Dihydropyrimidinase-related protein...
Dpysl4
593Annotation score:
D3Z360D3Z360_MOUSE
Dihydropyrimidinase-related protein...
Dpysl4
156Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti125 – 126ER → DG in CAA70299 (PubMed:9652388).Curated2
Sequence conflicti354G → V in CAA70299 (PubMed:9652388).Curated1
Sequence conflicti420F → I in CAA70299 (PubMed:9652388).Curated1
Sequence conflicti420F → I in BAE26556 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0248021 – 13MSFQG…IPRIT → MAYKMSQSISVTLGKDIPSR LRCLPQRPLFSLCQ in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006715 mRNA Translation: BAA21888.1
Y09079 mRNA Translation: CAA70299.1
AK145638 mRNA Translation: BAE26556.1
CCDSiCCDS21951.1 [O35098-1]
UniGeneiMm.250414

Genome annotation databases

UCSCiuc009kfk.2 mouse [O35098-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB006715 mRNA Translation: BAA21888.1
Y09079 mRNA Translation: CAA70299.1
AK145638 mRNA Translation: BAE26556.1
CCDSiCCDS21951.1 [O35098-1]
UniGeneiMm.250414

3D structure databases

ProteinModelPortaliO35098
SMRiO35098
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiO35098, 3 interactors
MINTiO35098
STRINGi10090.ENSMUSP00000026551

Protein family/group databases

MEROPSiM38.977

PTM databases

iPTMnetiO35098
PhosphoSitePlusiO35098
SwissPalmiO35098

2D gel databases

REPRODUCTION-2DPAGEiO35098

Proteomic databases

MaxQBiO35098
PaxDbiO35098
PeptideAtlasiO35098
PRIDEiO35098

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc009kfk.2 mouse [O35098-2]

Organism-specific databases

MGIiMGI:1349764 Dpysl4

Phylogenomic databases

eggNOGiKOG2584 Eukaryota
COG0044 LUCA
HOGENOMiHOG000219145
HOVERGENiHBG000806
InParanoidiO35098
PhylomeDBiO35098

Miscellaneous databases

PROiPR:O35098
SOURCEiSearch...

Gene expression databases

CleanExiMM_DPYSL4

Family and domain databases

CDDicd01314 D-HYD, 1 hit
Gene3Di2.30.40.10, 1 hit
InterProiView protein in InterPro
IPR006680 Amidohydro-rel
IPR030612 DRP4
IPR011778 Hydantoinase/dihydroPyrase
IPR011059 Metal-dep_hydrolase_composite
IPR032466 Metal_Hydrolase
PANTHERiPTHR11647:SF55 PTHR11647:SF55, 1 hit
PfamiView protein in Pfam
PF01979 Amidohydro_1, 1 hit
SUPFAMiSSF51338 SSF51338, 2 hits
SSF51556 SSF51556, 1 hit
TIGRFAMsiTIGR02033 D-hydantoinase, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDPYL4_MOUSE
AccessioniPrimary (citable) accession number: O35098
Secondary accession number(s): O08886, Q3UL94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again