UniProtKB - O16850 (FOXO_CAEEL)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|O16850|FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans OX=6239 GN=daf-16 PE=1 SV=3 MQLEQKSSLHCSKCRNFLQKFSQDMQAWNCRELDSPLPSDITLHNLEPARPDSGMSFSTD FDDDFFNLDLHQQERSASFGGVTQYSQQFLREKCSFSPYFHTSLETVDSGRTSLYGSNEQ CGQLGGASSNGSTAMLHTPDGSNSHQTSFPSDFRMSESPDDTVSGKKTTTRRNAWGNMSY AELITTAIMASPEKRLTLAQVYEWMVQNVPYFRDKGDSNSSAGWKNSIRHNLSLHSRFMR IQNEGAGKSSWWVINPDAKPGRNPRRTRERSNTIETTTKAQLEKSRRGAKKRIKERALMG SLHSTLNGNSIAGSIQTISHDLYDDDSMQGAFDNVPSSFRPRTQSNLSIPGSSSRVSPAI GSDIYDDLEFPSWVGESVPAIPSDIVDRTDQMRIDATTHIGGVQIKQESKPIKTEPIAPP PSYHELNSVRGSCAQNPLLRNPIVPSTNFKPMPLPGAYGNYQNGGITPINWLSTSNSSPL PGIQSCGIVAAQHTVASSSALPIDLENLTLPDQPLMDTMDVDALIRHELSQAGGQHIHFD L
- Align
Protein
Forkhead box protein O
Gene
daf-16
Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Forkhead-type transcription factor (PubMed:9360933). Binds to the promoters of genes that contain the daf-16 binding element (DBE), TTGTTTAC, in their regulatory region (PubMed:10880363). Functions in the Insulin/IGF-1-like signaling (IIS) mediated pathway which affects lipogenesis, lifespan, starvation survival, heat shock and oxidative stress responses, and dauer formation (PubMed:9360933, PubMed:8247153, PubMed:11747821, PubMed:11747825, PubMed:11381260, PubMed:14622602, PubMed:12750521, PubMed:17900900, PubMed:18358814, PubMed:18762027, PubMed:18832074, PubMed:19103192, PubMed:21531333, PubMed:22081913). Longevity signaling predominantly arises from expression in the intestine (PubMed:14622602). Daf-16 transcriptional activity is negatively regulated by cytoplasmic sequestration by association with ftt-2 (PubMed:11381260, PubMed:21531333). Inhibition is required for the carbon dioxide (CO2) avoidance response (PubMed:18524954). Upon loss of inhibition, daf-16 translocates to the nucleus to regulate genes that result in delayed reproduction and growth while increasing stress resistance starvation tolerance and longevity (PubMed:11747825, PubMed:21531333). Association with arginine methyltransferase prmt-1 prevents phosphorylation and allows for translocation to the nucleus and the subsequent transcription of longevity-related genes (PubMed:21531333). Modulation of its activity by cGMP levels in sensory neurons regulates lifespan (PubMed:19489741). Has a protective role against muscle dystrophy (PubMed:18397876). Involved in mediating protection against aberrant protein aggregation proteotoxicity (PubMed:16902091). Influences transcription of genes that code for proteins involved in immunity as part of a general stress response (PubMed:17096597, PubMed:18245330). Targets genes that inhibit and stimulate tumor growth (PubMed:17934462). Targets kinases, phosphatases and transcription factors that are primarily involved in signaling and gene regulation (PubMed:24516399). Thought to regulate ins-7 in FOXO-to-FOXO signaling, which coordinates daf-16 expression (PubMed:18025456). Activity is positively regulated by shc-1-mediated inhibition of daf-2 and activation of JNK pathway (PubMed:18832074). Functions by indirect interaction with jnk-1 of the mitogen-activated protein kinase (MAPK) pathway (PubMed:17894411). Involved in increased proteasome activity by activating expression of rpn-6.1 in response to proteotoxic stress, leading to enhanced assembly of the 26S proteasome, followed by higher proteasome activity (PubMed:22922647). Represses transcription of natc-1 (PubMed:25330323). Involved in regulation of srh-234 expression (PubMed:25357003). Binds to the promoter of the AMPK-gamma regulatory subunit, aakg-4, and activates its transcription (PubMed:24516399). Also activates transcription of AMPK-gamma regulatory subunit, aakg-1 (PubMed:24516399). Maintains endoplasmic reticulum (ER) function by inducing protein degradation and elimination to remove misfolded secretory proteins from the ER independently of the ire-1/xbp-1 unfolded protein response pathway (PubMed:25448701). Regulates epidermal innate immunity to nematophagous fungal infection and physical wounding which trigger bli-3 induced ROS release, leading to daf-16 activation independently of daf-2 signaling (PubMed:24146615). May negatively regulate resistance to stress caused by oxidized cholesterol adducts by preventing the activation of daf-9 and nuclear hormone receptor daf-12, two members of the steroid signaling pathway (PubMed:24957743). Promotes apoptosis during embryonic development (PubMed:25383666).32 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.2"daf-16: An HNF-3/forkhead family member that can function to double the life-span of Caenorhabditis elegans."
Lin K., Dorman J.B., Rodan A., Kenyon C.
Science 278:1319-1322(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), FUNCTION, DISRUPTION PHENOTYPE. - Ref.4"A C. elegans mutant that lives twice as long as wild type."
Kenyon C., Chang J., Gensch E., Rudner A., Tabtiang R.
Nature 366:461-464(1993) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.5"Identification of the differential distribution patterns of mRNAs and consensus binding sequences for mouse DAF-16 homologues."
Furuyama T., Nakazawa T., Nakano I., Mori N.
Biochem. J. 349:629-634(2000) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.6"Regulation of C. elegans DAF-16 and its human ortholog FKHRL1 by the daf-2 insulin-like signaling pathway."
Lee R.Y., Hench J., Ruvkun G.
Curr. Biol. 11:1950-1957(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY. - Ref.7"daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans."
Henderson S.T., Johnson T.E.
Curr. Biol. 11:1975-1980(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.8"Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling."
Lin K., Hsin H., Libina N., Kenyon C.
Nat. Genet. 28:139-145(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-271; THR-273 AND SER-345. - Ref.9"Tissue-specific activities of C. elegans DAF-16 in the regulation of lifespan."
Libina N., Berman J.R., Kenyon C.
Cell 115:489-502(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY. - Ref.10"Regulation of aging and age-related disease by DAF-16 and heat-shock factor."
Hsu A.L., Murphy C.T., Kenyon C.
Science 300:1142-1145(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.14"p38 MAPK regulates expression of immune response genes and contributes to longevity in C. elegans."
Troemel E.R., Chu S.W., Reinke V., Lee S.S., Ausubel F.M., Kim D.H.
PLoS Genet. 2:E183-E183(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.15"Opposing activities protect against age-onset proteotoxicity."
Cohen E., Bieschke J., Perciavalle R.M., Kelly J.W., Dillin A.
Science 313:1604-1610(2006) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.17"An AMPK-FOXO pathway mediates longevity induced by a novel method of dietary restriction in C. elegans."
Greer E.L., Dowlatshahi D., Banko M.R., Villen J., Hoang K., Blanchard D., Gygi S.P., Brunet A.
Curr. Biol. 17:1646-1656(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.19"DAF-16/FOXO targets genes that regulate tumor growth in Caenorhabditis elegans."
Pinkston-Gosse J., Kenyon C.
Nat. Genet. 39:1403-1409(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.20"Tissue entrainment by feedback regulation of insulin gene expression in the endoderm of Caenorhabditis elegans."
Murphy C.T., Lee S.J., Kenyon C.
Proc. Natl. Acad. Sci. U.S.A. 104:19046-19050(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.21"Direct inhibition of the longevity-promoting factor SKN-1 by insulin-like signaling in C. elegans."
Tullet J.M., Hertweck M., An J.H., Baker J., Hwang J.Y., Liu S., Oliveira R.P., Baumeister R., Blackwell T.K.
Cell 132:1025-1038(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, PHOSPHORYLATION BY AKT-1; AKT-2 AND SGK-1. - Ref.22"A 13C isotope labeling strategy reveals the influence of insulin signaling on lipogenesis in C. elegans."
Perez C.L., Van Gilst M.R.
Cell Metab. 8:266-274(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.23"SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans."
Neumann-Haefelin E., Qi W., Finkbeiner E., Walz G., Baumeister R., Hertweck M.
Genes Dev. 22:2721-2735(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION. - Ref.24"DAF-16-dependent suppression of immunity during reproduction in Caenorhabditis elegans."
Miyata S., Begun J., Troemel E.R., Ausubel F.M.
Genetics 178:903-918(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.25"Sirtuin inhibition protects from the polyalanine muscular dystrophy protein PABPN1."
Catoire H., Pasco M.Y., Abu-Baker A., Holbert S., Tourette C., Brais B., Rouleau G.A., Parker J.A., Neri C.
Hum. Mol. Genet. 17:2108-2117(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.26"The MAP kinase JNK-1 of Caenorhabditis elegans: location, activation, and influences over temperature-dependent insulin-like signaling, stress responses, and fitness."
Wolf M., Nunes F., Henkel A., Heinick A., Paul R.J.
J. Cell. Physiol. 214:721-729(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.27"A carbon dioxide avoidance behavior is integrated with responses to ambient oxygen and food in Caenorhabditis elegans."
Bretscher A.J., Busch K.E., de Bono M.
Proc. Natl. Acad. Sci. U.S.A. 105:8044-8049(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.28"Endogenous cGMP regulates adult longevity via the insulin signaling pathway in Caenorhabditis elegans."
Hahm J.H., Kim S., Paik Y.K.
Aging Cell 8:473-483(2009) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.29"Combined informatic and expression screen identifies the novel DAF-16 target HLH-13."
Liachko N., Davidowitz R., Lee S.S.
Dev. Biol. 327:97-105(2009) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.32"New genes that extend Caenorhabditis elegans' lifespan in response to reproductive signals."
McCormick M., Chen K., Ramaswamy P., Kenyon C.
Aging Cell 11:192-202(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.35"RPN-6 determines C. elegans longevity under proteotoxic stress conditions."
Vilchez D., Morantte I., Liu Z., Douglas P.M., Merkwirth C., Rodrigues A.P., Manning G., Dillin A.
Nature 489:263-268(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION. - Ref.38"The DAF-16/FOXO transcription factor functions as a regulator of epidermal innate immunity."
Zou C.G., Tu Q., Niu J., Ji X.L., Zhang K.Q.
PLoS Pathog. 9:E1003660-E1003660(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE. - Ref.39"The FOXO transcription factor DAF-16 bypasses ire-1 requirement to promote endoplasmic reticulum hoymeostasis."
Safra M., Fickentscher R., Levi-Ferber M., Danino Y.M., Haviv-Chesner A., Hansen M., Juven-Gershon T., Weiss M., Henis-Korenblit S.
Cell Metab. 20:870-881(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.40"The zinc matrix metalloproteinase ZMP-2 increases survival of Caenorhabditis elegans through interference with lipoprotein absorption."
Fischer M., Fitzenberger E., Kull R., Boll M., Wenzel U.
Genes Nutr. 9:414-414(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.41"Caspase-activated phosphoinositide binding by CNT-1 promotes apoptosis by inhibiting the AKT pathway."
Nakagawa A., Sullivan K.D., Xue D.
Nat. Struct. Mol. Biol. 21:1082-1090(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.42"DAF-16/FoxO directly regulates an atypical AMP-activated protein kinase gamma isoform to mediate the effects of insulin/IGF-1 signaling on aging in Caenorhabditis elegans."
Tullet J.M., Araiz C., Sanders M.J., Au C., Benedetto A., Papatheodorou I., Clark E., Schmeisser K., Jones D., Schuster E.F., Thornton J.M., Gems D.
PLoS Genet. 10:E1004109-E1004109(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.43"The DAF-16 FOXO transcription factor regulates natc-1 to modulate stress resistance in Caenorhabditis elegans, linking insulin/IGF-1 signaling to protein N-terminal acetylation."
Warnhoff K., Murphy J.T., Kumar S., Schneider D.L., Peterson M., Hsu S., Guthrie J., Robertson J.D., Kornfeld K.
PLoS Genet. 10:E1004703-E1004703(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.44"Feeding state, insulin and NPR-1 modulate Chemoreceptor gene expression via integration of sensory and circuit inputs."
Gruner M., Nelson D., Winbush A., Hintz R., Ryu L., Chung S.H., Kim K., Gabel C.V., van der Linden A.M.
PLoS Genet. 10:E1004707-E1004707(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE.
Regions
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi | 175 – 268 | Fork-headPROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 94 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- 14-3-3 protein binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- activating transcription factor binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- beta-catenin binding Source: ParkinsonsUK-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- DEAD/H-box RNA helicase binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- DNA binding transcription factor activity Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- enzyme binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- RNA polymerase II regulatory region sequence-specific DNA binding Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: GO_Central
- sequence-specific DNA binding Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- ubiquitin protein ligase binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- ubiquitin-specific protease binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- aging Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- anatomical structure morphogenesis Source: GO_Central
- cell differentiation Source: GO_Central
- cellular response to DNA damage stimulus Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- cellular response to heat Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- cellular response to oxidative stress Source: ParkinsonsUK-UCL <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- dauer larval development Source: WormBase <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- defense response to Gram-negative bacterium Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- defense response to Gram-positive bacterium Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- determination of adult lifespan Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- heat acclimation Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- innate immune response Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- insulin receptor signaling pathway Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- muscle tissue development Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of multicellular organism growth Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- negative regulation of transcription by RNA polymerase II Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- nematode larval development Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of adaptive immune response Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of apoptotic process Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of dauer larval development Source: WormBase <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of defense response to bacterium Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of gene expression Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- positive regulation of neuromuscular synaptic transmission Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- positive regulation of synaptic growth at neuromuscular junction Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- positive regulation of transcription by RNA polymerase II Source: WormBase <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- regulation of cell cycle process Source: UniProtKB <p>Inferred from Expression Pattern</p> <p>Covers cases where the annotation is inferred from the timing or location of expression of a gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#iep">GO evidence code guide</a></p> Inferred from expression patterni
- regulation of dauer entry Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of dauer larval development Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of DNA-templated transcription in response to stress Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of gene expression Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of lipid biosynthetic process Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- regulation of lipid storage Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of synaptic growth at neuromuscular junction Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- regulation of transcription, DNA-templated Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- response to oxidative stress Source: UniProtKB <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- response to starvation Source: UniProtKB <p>Inferred from Mutant Phenotype</p> <p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#imp">GO evidence code guide</a></p> Inferred from mutant phenotypei
- response to UV Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- short-term memory Source: WormBase <p>Inferred from Genetic Interaction</p> <p>Used to describe “traditional” genetic interactions such as suppressors and synthetic lethals as well as other techniques such as functional complementation, rescue experiments, or inferences about a gene drawn from the phenotype of a mutation in a different gene.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#igi">GO evidence code guide</a></p> Inferred from genetic interactioni
- transcription, DNA-templated Source: UniProtKB-KW
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Developmental protein, DNA-binding, Repressor |
| Biological process | Growth regulation, Immunity, Innate immunity, Stress response, Transcription, Transcription regulation |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-CEL-198693 AKT phosphorylates targets in the nucleus R-CEL-211163 AKT-mediated inactivation of FOXO1A R-CEL-5687128 MAPK6/MAPK4 signaling |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | O16850 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Forkhead box protein OCuratedShort name: FOXO1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
Alternative name(s): Abnormal dauer formation protein 16Imported <p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More...</a></p> Manual assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:daf-16Imported <p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More...</a></p> Manual assertion inferred from database entriesi ORF Names:R13H8.1Imported <p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More...</a></p> Manual assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Caenorhabditis elegans |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 6239 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Protostomia › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
WormBase More...WormBasei | R13H8.1a ; CE28771 ; WBGene00000912 ; daf-16 R13H8.1b ; CE28772 ; WBGene00000912 ; daf-16 R13H8.1c ; CE28773 ; WBGene00000912 ; daf-16 R13H8.1d ; CE38722 ; WBGene00000912 ; daf-16 R13H8.1e ; CE33160 ; WBGene00000912 ; daf-16 R13H8.1f ; CE44821 ; WBGene00000912 ; daf-16 R13H8.1g ; CE44935 ; WBGene00000912 ; daf-16 R13H8.1h ; CE45185 ; WBGene00000912 ; daf-16 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Nucleus
- Nucleus 11 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans."
Henderson S.T., Johnson T.E.
Curr. Biol. 11:1975-1980(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.8"Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling."
Lin K., Hsin H., Libina N., Kenyon C.
Nat. Genet. 28:139-145(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-271; THR-273 AND SER-345. - Ref.11"The p38 signal transduction pathway participates in the oxidative stress-mediated translocation of DAF-16 to Caenorhabditis elegans nuclei."
Kondo M., Yanase S., Ishii T., Hartman P.S., Matsumoto K., Ishii N.
Mech. Ageing Dev. 126:642-647(2005) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.12"JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16."
Oh S.W., Mukhopadhyay A., Svrzikapa N., Jiang F., Davis R.J., Tissenbaum H.A.
Proc. Natl. Acad. Sci. U.S.A. 102:4494-4499(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH JNK-1, SUBCELLULAR LOCATION, PHOSPHORYLATION. - Ref.16"Effects of the flavonoids kaempferol and fisetin on thermotolerance, oxidative stress and FoxO transcription factor DAF-16 in the model organism Caenorhabditis elegans."
Kampkotter A., Gombitang Nkwonkam C., Zurawski R.F., Timpel C., Chovolou Y., Watjen W., Kahl R.
Arch. Toxicol. 81:849-858(2007) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.23"SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans."
Neumann-Haefelin E., Qi W., Finkbeiner E., Walz G., Baumeister R., Hertweck M.
Genes Dev. 22:2721-2735(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION. - Ref.26"The MAP kinase JNK-1 of Caenorhabditis elegans: location, activation, and influences over temperature-dependent insulin-like signaling, stress responses, and fitness."
Wolf M., Nunes F., Henkel A., Heinick A., Paul R.J.
J. Cell. Physiol. 214:721-729(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.30"Feeding a ROS-generator to Caenorhabditis elegans leads to increased expression of small heat shock protein HSP-16.2 and hormesis."
Hartwig K., Heidler T., Moch J., Daniel H., Wenzel U.
Genes Nutr. 4:59-67(2009) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.37"CAMKII and Calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16."
Tao L., Xie Q., Ding Y.H., Li S.T., Peng S., Zhang Y.P., Tan D., Yuan Z., Dong M.Q.
Elife 2:E00518-E00518(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH UNC-43 AND TAX-6, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-319, DISRUPTION PHENOTYPE, MUTAGENESIS OF SER-319. - Ref.38"The DAF-16/FOXO transcription factor functions as a regulator of epidermal innate immunity."
Zou C.G., Tu Q., Niu J., Ji X.L., Zhang K.Q.
PLoS Pathog. 9:E1003660-E1003660(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
- Nucleus 11 Publications
Other locations
- Cytoplasm 11 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.7"daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans."
Henderson S.T., Johnson T.E.
Curr. Biol. 11:1975-1980(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.8"Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling."
Lin K., Hsin H., Libina N., Kenyon C.
Nat. Genet. 28:139-145(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-271; THR-273 AND SER-345. - Ref.11"The p38 signal transduction pathway participates in the oxidative stress-mediated translocation of DAF-16 to Caenorhabditis elegans nuclei."
Kondo M., Yanase S., Ishii T., Hartman P.S., Matsumoto K., Ishii N.
Mech. Ageing Dev. 126:642-647(2005) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.12"JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16."
Oh S.W., Mukhopadhyay A., Svrzikapa N., Jiang F., Davis R.J., Tissenbaum H.A.
Proc. Natl. Acad. Sci. U.S.A. 102:4494-4499(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH JNK-1, SUBCELLULAR LOCATION, PHOSPHORYLATION. - Ref.16"Effects of the flavonoids kaempferol and fisetin on thermotolerance, oxidative stress and FoxO transcription factor DAF-16 in the model organism Caenorhabditis elegans."
Kampkotter A., Gombitang Nkwonkam C., Zurawski R.F., Timpel C., Chovolou Y., Watjen W., Kahl R.
Arch. Toxicol. 81:849-858(2007) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.23"SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans."
Neumann-Haefelin E., Qi W., Finkbeiner E., Walz G., Baumeister R., Hertweck M.
Genes Dev. 22:2721-2735(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION. - Ref.26"The MAP kinase JNK-1 of Caenorhabditis elegans: location, activation, and influences over temperature-dependent insulin-like signaling, stress responses, and fitness."
Wolf M., Nunes F., Henkel A., Heinick A., Paul R.J.
J. Cell. Physiol. 214:721-729(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.30"Feeding a ROS-generator to Caenorhabditis elegans leads to increased expression of small heat shock protein HSP-16.2 and hormesis."
Hartwig K., Heidler T., Moch J., Daniel H., Wenzel U.
Genes Nutr. 4:59-67(2009) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.37"CAMKII and Calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16."
Tao L., Xie Q., Ding Y.H., Li S.T., Peng S., Zhang Y.P., Tan D., Yuan Z., Dong M.Q.
Elife 2:E00518-E00518(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH UNC-43 AND TAX-6, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-319, DISRUPTION PHENOTYPE, MUTAGENESIS OF SER-319. - Ref.38"The DAF-16/FOXO transcription factor functions as a regulator of epidermal innate immunity."
Zou C.G., Tu Q., Niu J., Ji X.L., Zhang K.Q.
PLoS Pathog. 9:E1003660-E1003660(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
Note: Shuttles between cytoplasm and nucleus (PubMed:11381260, PubMed:17894411). Nuclear translocation is inhibited by phosphorylation by AKT proteins (PubMed:11381260, PubMed:11747825, PubMed:21531333). Association with ftt-2 sequesters daf-16 in the cytoplasm (PubMed:21531333). Association with prmt-1 allows for translocation to the nucleus (PubMed:21531333). Nuclear translocation is promoted by phosphorylation by unc-43 and inhibited by dephosphorylation by tax-6 (PubMed:23805378). Nuclear translocation is promoted by jnk-1 upon heat stress and by sek-1 upon oxidative stress (PubMed:15888317, PubMed:15767565). Nucleocytoplasmic shuttling is induced by starvation, heat treatment, hypergravity, reactive oxygen species (generated by juglone), exposure to tributyltin or 4-hydroxy-E-globularinin (4-HEG) and the flavonoids kaempferol and fisetin (PubMed:11381260, PubMed:17551714, PubMed:18832074, PubMed:19252938, PubMed:21531333, PubMed:23805378). Nuclear localization induced by nematophagous fungal infection (PubMed:24146615).10 Publications- Cytoplasm 11 Publications
- Ref.7"daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans."
Henderson S.T., Johnson T.E.
Curr. Biol. 11:1975-1980(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.8"Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling."
Lin K., Hsin H., Libina N., Kenyon C.
Nat. Genet. 28:139-145(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-271; THR-273 AND SER-345. - Ref.11"The p38 signal transduction pathway participates in the oxidative stress-mediated translocation of DAF-16 to Caenorhabditis elegans nuclei."
Kondo M., Yanase S., Ishii T., Hartman P.S., Matsumoto K., Ishii N.
Mech. Ageing Dev. 126:642-647(2005) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.12"JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16."
Oh S.W., Mukhopadhyay A., Svrzikapa N., Jiang F., Davis R.J., Tissenbaum H.A.
Proc. Natl. Acad. Sci. U.S.A. 102:4494-4499(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH JNK-1, SUBCELLULAR LOCATION, PHOSPHORYLATION. - Ref.16"Effects of the flavonoids kaempferol and fisetin on thermotolerance, oxidative stress and FoxO transcription factor DAF-16 in the model organism Caenorhabditis elegans."
Kampkotter A., Gombitang Nkwonkam C., Zurawski R.F., Timpel C., Chovolou Y., Watjen W., Kahl R.
Arch. Toxicol. 81:849-858(2007) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.23"SHC-1/p52Shc targets the insulin/IGF-1 and JNK signaling pathways to modulate life span and stress response in C. elegans."
Neumann-Haefelin E., Qi W., Finkbeiner E., Walz G., Baumeister R., Hertweck M.
Genes Dev. 22:2721-2735(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION. - Ref.26"The MAP kinase JNK-1 of Caenorhabditis elegans: location, activation, and influences over temperature-dependent insulin-like signaling, stress responses, and fitness."
Wolf M., Nunes F., Henkel A., Heinick A., Paul R.J.
J. Cell. Physiol. 214:721-729(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.30"Feeding a ROS-generator to Caenorhabditis elegans leads to increased expression of small heat shock protein HSP-16.2 and hormesis."
Hartwig K., Heidler T., Moch J., Daniel H., Wenzel U.
Genes Nutr. 4:59-67(2009) [PubMed] [Europe PMC] [Abstract]Cited for: SUBCELLULAR LOCATION. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.38"The DAF-16/FOXO transcription factor functions as a regulator of epidermal innate immunity."
Zou C.G., Tu Q., Niu J., Ji X.L., Zhang K.Q.
PLoS Pathog. 9:E1003660-E1003660(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE.
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
Cytosol
- cytosol Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Nucleus
- nucleus Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Other locations
- cytoplasm Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Cytoplasm, Nucleus<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei
Dauer defective phenotype in larvae and a reduced stress phenotype in adults (PubMed:9360933). Increased carbonyl accumulation and increased sensitivity to starvation (PubMed:18025456). Increased expression of the srh-234 chemoreceptor during starvation (PubMed:25357003). Increased sensitivity to physical injury and more susceptible to death by nematophagous fungal infection (PubMed:24146615). Increased lifespan (PubMed:23805378). Causes a delay in apoptosis during embryonic development (PubMed:25383666). RNAi-mediated knock-down reduces expression of daf-16 target genes and genes up-regulated in response to nematophagous fungal infection such as sod-3 (PubMed:24146615). RNAi-mediated knockdown causes reduced ability of dietary restriction to extend lifespan (PubMed:17900900). Simultaneous RNAi-mediated knockdown of metalloproteinase zmp-2 restores normal survival upon heat stress and prevents increased susceptibility to heat stress in a daf-9 or daf-12 mutant background (PubMed:24957743).8 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.2"daf-16: An HNF-3/forkhead family member that can function to double the life-span of Caenorhabditis elegans."
Lin K., Dorman J.B., Rodan A., Kenyon C.
Science 278:1319-1322(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), FUNCTION, DISRUPTION PHENOTYPE. - Ref.17"An AMPK-FOXO pathway mediates longevity induced by a novel method of dietary restriction in C. elegans."
Greer E.L., Dowlatshahi D., Banko M.R., Villen J., Hoang K., Blanchard D., Gygi S.P., Brunet A.
Curr. Biol. 17:1646-1656(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.20"Tissue entrainment by feedback regulation of insulin gene expression in the endoderm of Caenorhabditis elegans."
Murphy C.T., Lee S.J., Kenyon C.
Proc. Natl. Acad. Sci. U.S.A. 104:19046-19050(2007) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.37"CAMKII and Calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16."
Tao L., Xie Q., Ding Y.H., Li S.T., Peng S., Zhang Y.P., Tan D., Yuan Z., Dong M.Q.
Elife 2:E00518-E00518(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH UNC-43 AND TAX-6, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-319, DISRUPTION PHENOTYPE, MUTAGENESIS OF SER-319. - Ref.38"The DAF-16/FOXO transcription factor functions as a regulator of epidermal innate immunity."
Zou C.G., Tu Q., Niu J., Ji X.L., Zhang K.Q.
PLoS Pathog. 9:E1003660-E1003660(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE. - Ref.40"The zinc matrix metalloproteinase ZMP-2 increases survival of Caenorhabditis elegans through interference with lipoprotein absorption."
Fischer M., Fitzenberger E., Kull R., Boll M., Wenzel U.
Genes Nutr. 9:414-414(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE. - Ref.41"Caspase-activated phosphoinositide binding by CNT-1 promotes apoptosis by inhibiting the AKT pathway."
Nakagawa A., Sullivan K.D., Xue D.
Nat. Struct. Mol. Biol. 21:1082-1090(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.44"Feeding state, insulin and NPR-1 modulate Chemoreceptor gene expression via integration of sensory and circuit inputs."
Gruner M., Nelson D., Winbush A., Hintz R., Ryu L., Chung S.H., Kim K., Gabel C.V., van der Linden A.M.
PLoS Genet. 10:E1004707-E1004707(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, DISRUPTION PHENOTYPE.
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 266 | R → K: Decreases methylation by prmt-1; when associated with K-268 and K-270. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 268 | R → K: Decreases methylation by prmt-1; when associated with K-266 and K-270. Prevents phosphorylation by akt 1 and/or 2; when associated with K-270. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 270 | R → K: Decreases methylation by prmt-1; when associated with K-266 and K-268. Prevents phosphorylation by akt 1 and/or 2; when associated with K-268. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 271 | S → A: Prevents phosphorylation and results in strong nuclear localization. Reduces phosphorylation; when associated with A-273. 2 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 273 | T → A: Prevents phosphorylation and results in strong nuclear localization. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 273 | T → A: Reduces phosphorylation in normal and starved conditions. Reduces phosphorylation; when associated with A-271. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 319 | S → A: Prevents phosphorylation and results in cytoplasmic localization in unc-43 n498 gain-of-function or tax-6 mutant backgrounds. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 319 | S → D: Phosphomimetic mutant which causes constitutive nuclear localization. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 345 | S → A: Prevents phosphorylation and results in strong nuclear localization. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000414886 | 1 – 541 | Forkhead box protein OCuratedAdd BLAST | 541 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 273 | Phosphothreonine1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 319 | Phosphoserine; by CaMK21 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
Phosphorylated by akt-1 and/or akt-2 (PubMed:18358814, PubMed:21531333). Phosphorylated by sgk-1 (PubMed:18358814). Phosphorylated by unc-43 (PubMed:23805378). Phosphorylated by jnk-1 (PubMed:15767565). Dephosphorylated by tax-6 in vitro (PubMed:23805378).4 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.12"JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16."
Oh S.W., Mukhopadhyay A., Svrzikapa N., Jiang F., Davis R.J., Tissenbaum H.A.
Proc. Natl. Acad. Sci. U.S.A. 102:4494-4499(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH JNK-1, SUBCELLULAR LOCATION, PHOSPHORYLATION. - Ref.21"Direct inhibition of the longevity-promoting factor SKN-1 by insulin-like signaling in C. elegans."
Tullet J.M., Hertweck M., An J.H., Baker J., Hwang J.Y., Liu S., Oliveira R.P., Baumeister R., Blackwell T.K.
Cell 132:1025-1038(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, PHOSPHORYLATION BY AKT-1; AKT-2 AND SGK-1. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.37"CAMKII and Calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16."
Tao L., Xie Q., Ding Y.H., Li S.T., Peng S., Zhang Y.P., Tan D., Yuan Z., Dong M.Q.
Elife 2:E00518-E00518(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH UNC-43 AND TAX-6, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-319, DISRUPTION PHENOTYPE, MUTAGENESIS OF SER-319.
Ubiquitinated. Ubiquitination by rle-1 leads to proteasome-mediated degradation.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.18"RLE-1, an E3 ubiquitin ligase, regulates C. elegans aging by catalyzing DAF-16 polyubiquitination."
Li W., Gao B., Lee S.-M., Bennett K., Fang D.
Dev. Cell 12:235-246(2007) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH RLE-1, UBIQUITINATION.
Methylation by prmt-1 prevents phosphorylation and promotes translocation to the nucleus to allow for daf-16-dependent transcription.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Phosphoprotein, Ubl conjugationProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | O16850 |
PeptideAtlas More...PeptideAtlasi | O16850 |
PRoteomics IDEntifications database More...PRIDEi | O16850 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | O16850 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Isoform b and isoform c are expressed in ectoderm, muscles, intestine and neurons (PubMed:9353126, PubMed:11747825, PubMed:14622602, PubMed:17894411). Isoform b is also expressed in the pharynx (PubMed:11747821). The intestine appears to be the primary site of longevity function (PubMed:14622602).5 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. - Ref.6"Regulation of C. elegans DAF-16 and its human ortholog FKHRL1 by the daf-2 insulin-like signaling pathway."
Lee R.Y., Hench J., Ruvkun G.
Curr. Biol. 11:1950-1957(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY. - Ref.7"daf-16 integrates developmental and environmental inputs to mediate aging in the nematode Caenorhabditis elegans."
Henderson S.T., Johnson T.E.
Curr. Biol. 11:1975-1980(2001) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. - Ref.9"Tissue-specific activities of C. elegans DAF-16 in the regulation of lifespan."
Libina N., Berman J.R., Kenyon C.
Cell 115:489-502(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, TISSUE SPECIFICITY. - Ref.26"The MAP kinase JNK-1 of Caenorhabditis elegans: location, activation, and influences over temperature-dependent insulin-like signaling, stress responses, and fitness."
Wolf M., Nunes F., Henkel A., Heinick A., Paul R.J.
J. Cell. Physiol. 214:721-729(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei
Expressed in embryos, larvae, dauer larvae and adults.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni
Induced by quinic acid.1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.36"Quinic acid could be a potential rejuvenating natural compound by improving survival of Caenorhabditis elegans under deleterious conditions."
Zhang L., Zhang J., Zhao B., Zhao-Wilson X.
Rejuvenation Res. 15:573-583(2012) [PubMed] [Europe PMC] [Abstract]Cited for: INDUCTION BY QUINIC ACID.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | WBGene00000912 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | O16850 baseline and differential |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Interacts with rle-1 (PubMed:17276341). Interacts with unc-43 and tax-6 (PubMed:23805378). Interacts with jnk-1 (PubMed:15767565). Interacts with ftt-2 (PubMed:16777605, PubMed:21531333). Interacts with prmt-1 (PubMed:21531333).4 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.12"JNK regulates lifespan in Caenorhabditis elegans by modulating nuclear translocation of forkhead transcription factor/DAF-16."
Oh S.W., Mukhopadhyay A., Svrzikapa N., Jiang F., Davis R.J., Tissenbaum H.A.
Proc. Natl. Acad. Sci. U.S.A. 102:4494-4499(2005) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH JNK-1, SUBCELLULAR LOCATION, PHOSPHORYLATION. - Ref.18"RLE-1, an E3 ubiquitin ligase, regulates C. elegans aging by catalyzing DAF-16 polyubiquitination."
Li W., Gao B., Lee S.-M., Bennett K., Fang D.
Dev. Cell 12:235-246(2007) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH RLE-1, UBIQUITINATION. - Ref.31"Asymmetric arginine dimethylation determines life span in C. elegans by regulating forkhead transcription factor DAF-16."
Takahashi Y., Daitoku H., Hirota K., Tamiya H., Yokoyama A., Kako K., Nagashima Y., Nakamura A., Shimada T., Watanabe S., Yamagata K., Yasuda K., Ishii N., Fukamizu A.
Cell Metab. 13:505-516(2011) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, INTERACTION WITH FTT-2 AND PRMT-1, SUBCELLULAR LOCATION, PHOSPHORYLATION BY AKT, PHOSPHORYLATION AT THR-273, MUTAGENESIS OF ARG-266; ARG-268; ARG-270; SER-271 AND THR-273. - Ref.37"CAMKII and Calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16."
Tao L., Xie Q., Ding Y.H., Li S.T., Peng S., Zhang Y.P., Tan D., Yuan Z., Dong M.Q.
Elife 2:E00518-E00518(2013) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH UNC-43 AND TAX-6, SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-319, DISRUPTION PHENOTYPE, MUTAGENESIS OF SER-319.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| akt-1 | Q17941 | 3 | EBI-324028,EBI-1770718 | |
| akt-2 | Q9XTG7 | 3 | EBI-324028,EBI-320656 | |
| sgk-1 | Q2PJ68 | 3 | EBI-324028,EBI-1770776 | |
| sir-2.1 | Q21921 | 2 | EBI-324028,EBI-966082 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- 14-3-3 protein binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- activating transcription factor binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- beta-catenin binding Source: ParkinsonsUK-UCL <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- DEAD/H-box RNA helicase binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- enzyme binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- ubiquitin protein ligase binding Source: UniProtKB <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
- ubiquitin-specific protease binding Source: WormBase <p>Inferred from Physical Interaction</p> <p>Covers physical interactions between the gene product of interest and another molecule (or ion, or complex).</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ipi">GO evidence code guide</a></p> Inferred from physical interactioni
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 38392, 5 interactors |
Database of interacting proteins More...DIPi | DIP-25581N |
Protein interaction database and analysis system More...IntActi | O16850, 23 interactors |
STRING: functional protein association networks More...STRINGi | 6239.R13H8.1h |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | O16850 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | O16850 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG2294 Eukaryota COG5025 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00920000149005 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000019698 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | O16850 |
KEGG Orthology (KO) More...KOi | K09408 |
Identification of Orthologs from Complete Genome Data More...OMAi | SASSGNC |
Database of Orthologous Groups More...OrthoDBi | EOG091G06K3 |
Family and domain databases
Conserved Domains Database More...CDDi | cd00059 FH, 1 hit |
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.10.10.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001766 Fork_head_dom IPR030456 TF_fork_head_CS_2 IPR036388 WH-like_DNA-bd_sf IPR036390 WH_DNA-bd_sf |
Pfam protein domain database More...Pfami | View protein in Pfam PF00250 Forkhead, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00053 FORKHEAD |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00339 FH, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46785 SSF46785, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00658 FORK_HEAD_2, 1 hit PS50039 FORK_HEAD_3, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
Isoform hCurated (identifier: O16850-8) [UniParc]FASTAAdd to basketAdded to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MQLEQKSSLH CSKCRNFLQK FSQDMQAWNC RELDSPLPSD ITLHNLEPAR
60 70 80 90 100
PDSGMSFSTD FDDDFFNLDL HQQERSASFG GVTQYSQQFL REKCSFSPYF
110 120 130 140 150
HTSLETVDSG RTSLYGSNEQ CGQLGGASSN GSTAMLHTPD GSNSHQTSFP
160 170 180 190 200
SDFRMSESPD DTVSGKKTTT RRNAWGNMSY AELITTAIMA SPEKRLTLAQ
210 220 230 240 250
VYEWMVQNVP YFRDKGDSNS SAGWKNSIRH NLSLHSRFMR IQNEGAGKSS
260 270 280 290 300
WWVINPDAKP GRNPRRTRER SNTIETTTKA QLEKSRRGAK KRIKERALMG
310 320 330 340 350
SLHSTLNGNS IAGSIQTISH DLYDDDSMQG AFDNVPSSFR PRTQSNLSIP
360 370 380 390 400
GSSSRVSPAI GSDIYDDLEF PSWVGESVPA IPSDIVDRTD QMRIDATTHI
410 420 430 440 450
GGVQIKQESK PIKTEPIAPP PSYHELNSVR GSCAQNPLLR NPIVPSTNFK
460 470 480 490 500
PMPLPGAYGN YQNGGITPIN WLSTSNSSPL PGIQSCGIVA AQHTVASSSA
510 520 530 540
LPIDLENLTL PDQPLMDTMD VDALIRHELS QAGGQHIHFD L
Note: No experimental confirmation available.Curated
Show »Length:541
Mass (Da):59,732
Last modified:January 25, 2012 - v3
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i8A36A86311A32CBB
Isoform a1 PublicationShow »
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Also known as: b1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
The sequence of this isoform differs from the canonical sequence as follows:
1-221: MQLEQKSSLH...FRDKGDSNSS → MNDSIDDDFP...FGERSSPEEA
10 20 30 40 50
MNDSIDDDFP PEPRGRCYTW PMQQYIYQES SATIPHHHLN QHNNPYHPMH
60 70 80 90 100
PHHQLPHMQQ LPQPLLNLNM TTLTSSGSSV ASSIGGGAQC SPCASGSSTA
110 120 130 140 150
ATNSSQQQQT VGQMLAASVP CSSSGMTLGM SLNLSQGGGP MPAKKKRCRK
160 170 180 190 200
KPTDQLAQKK PNPWGEESYS DIIAKALESA PDGRLKLNEI YQWFSDNIPY
210 220 230 240 250
FGERSSPEEA AGWKNSIRHN LSLHSRFMRI QNEGAGKSSW WVINPDAKPG
260 270 280 290 300
RNPRRTRERS NTIETTTKAQ LEKSRRGAKK RIKERALMGS LHSTLNGNSI
310 320 330 340 350
AGSIQTISHD LYDDDSMQGA FDNVPSSFRP RTQSNLSIPG SSSRVSPAIG
360 370 380 390 400
SDIYDDLEFP SWVGESVPAI PSDIVDRTDQ MRIDATTHIG GVQIKQESKP
410 420 430 440 450
IKTEPIAPPP SYHELNSVRG SCAQNPLLRN PIVPSTNFKP MPLPGAYGNY
460 470 480 490 500
QNGGITPINW LSTSNSSPLP GIQSCGIVAA QHTVASSSAL PIDLENLTLP
510 520 530
DQPLMDTMDV DALIRHELSQ AGGQHIHFDL
Length:530
Mass (Da):57,899
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i8665FBDB428039D6
Isoform b1 PublicationShow »
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Also known as: a21 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
The sequence of this isoform differs from the canonical sequence as follows:
1-113: MQLEQKSSLH...LETVDSGRTS → MMEMLVDQGT...HEQIPEEDAD
152-154: DFR → E
10 20 30 40 50
MMEMLVDQGT DASSSASTST SSVSRFGADT FMNTPDDVMM NDDMEPIPRD
60 70 80 90 100
RCNTWPMRRP QLEPPLNSSP IIHEQIPEED ADLYGSNEQC GQLGGASSNG
110 120 130 140 150
STAMLHTPDG SNSHQTSFPS EMSESPDDTV SGKKTTTRRN AWGNMSYAEL
160 170 180 190 200
ITTAIMASPE KRLTLAQVYE WMVQNVPYFR DKGDSNSSAG WKNSIRHNLS
210 220 230 240 250
LHSRFMRIQN EGAGKSSWWV INPDAKPGRN PRRTRERSNT IETTTKAQLE
260 270 280 290 300
KSRRGAKKRI KERALMGSLH STLNGNSIAG SIQTISHDLY DDDSMQGAFD
310 320 330 340 350
NVPSSFRPRT QSNLSIPGSS SRVSPAIGSD IYDDLEFPSW VGESVPAIPS
360 370 380 390 400
DIVDRTDQMR IDATTHIGGV QIKQESKPIK TEPIAPPPSY HELNSVRGSC
410 420 430 440 450
AQNPLLRNPI VPSTNFKPMP LPGAYGNYQN GGITPINWLS TSNSSPLPGI
460 470 480 490 500
QSCGIVAAQH TVASSSALPI DLENLTLPDQ PLMDTMDVDA LIRHELSQAG
GQHIHFDL
Length:508
Mass (Da):55,578
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i2C0CF97657CD6350
Isoform c2 PublicationsShow »
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. - Ref.2"daf-16: An HNF-3/forkhead family member that can function to double the life-span of Caenorhabditis elegans."
Lin K., Dorman J.B., Rodan A., Kenyon C.
Science 278:1319-1322(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), FUNCTION, DISRUPTION PHENOTYPE.
Also known as: a11 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
The sequence of this isoform differs from the canonical sequence as follows:
1-113: MQLEQKSSLH...LETVDSGRTS → MMEMLVDQGT...HEQIPEEDAD
10 20 30 40 50
MMEMLVDQGT DASSSASTST SSVSRFGADT FMNTPDDVMM NDDMEPIPRD
60 70 80 90 100
RCNTWPMRRP QLEPPLNSSP IIHEQIPEED ADLYGSNEQC GQLGGASSNG
110 120 130 140 150
STAMLHTPDG SNSHQTSFPS DFRMSESPDD TVSGKKTTTR RNAWGNMSYA
160 170 180 190 200
ELITTAIMAS PEKRLTLAQV YEWMVQNVPY FRDKGDSNSS AGWKNSIRHN
210 220 230 240 250
LSLHSRFMRI QNEGAGKSSW WVINPDAKPG RNPRRTRERS NTIETTTKAQ
260 270 280 290 300
LEKSRRGAKK RIKERALMGS LHSTLNGNSI AGSIQTISHD LYDDDSMQGA
310 320 330 340 350
FDNVPSSFRP RTQSNLSIPG SSSRVSPAIG SDIYDDLEFP SWVGESVPAI
360 370 380 390 400
PSDIVDRTDQ MRIDATTHIG GVQIKQESKP IKTEPIAPPP SYHELNSVRG
410 420 430 440 450
SCAQNPLLRN PIVPSTNFKP MPLPGAYGNY QNGGITPINW LSTSNSSPLP
460 470 480 490 500
GIQSCGIVAA QHTVASSSAL PIDLENLTLP DQPLMDTMDV DALIRHELSQ
510
AGGQHIHFDL
Length:510
Mass (Da):55,867
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i52574F3F979B3583
Isoform d1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"The Fork head transcription factor DAF-16 transduces insulin-like metabolic and longevity signals in C. elegans."
Ogg S., Paradis S., Gottlieb S., Patterson G.I., Lee L., Tissenbaum H.A., Ruvkun G.
Nature 389:994-999(1997) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
The sequence of this isoform differs from the canonical sequence as follows:
1-54: Missing.
10 20 30 40 50
MSFSTDFDDD FFNLDLHQQE RSASFGGVTQ YSQQFLREKC SFSPYFHTSL
60 70 80 90 100
ETVDSGRTSL YGSNEQCGQL GGASSNGSTA MLHTPDGSNS HQTSFPSDFR
110 120 130 140 150
MSESPDDTVS GKKTTTRRNA WGNMSYAELI TTAIMASPEK RLTLAQVYEW
160 170 180 190 200
MVQNVPYFRD KGDSNSSAGW KNSIRHNLSL HSRFMRIQNE GAGKSSWWVI
210 220 230 240 250
NPDAKPGRNP RRTRERSNTI ETTTKAQLEK SRRGAKKRIK ERALMGSLHS
260 270 280 290 300
TLNGNSIAGS IQTISHDLYD DDSMQGAFDN VPSSFRPRTQ SNLSIPGSSS
310 320 330 340 350
RVSPAIGSDI YDDLEFPSWV GESVPAIPSD IVDRTDQMRI DATTHIGGVQ
360 370 380 390 400
IKQESKPIKT EPIAPPPSYH ELNSVRGSCA QNPLLRNPIV PSTNFKPMPL
410 420 430 440 450
PGAYGNYQNG GITPINWLST SNSSPLPGIQ SCGIVAAQHT VASSSALPID
460 470 480
LENLTLPDQP LMDTMDVDAL IRHELSQAGG QHIHFDL
Note: No experimental confirmation available.Curated
Show »Length:487
Mass (Da):53,518
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i6998CD8BF98A5747
Isoform e1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.3"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
The sequence of this isoform differs from the canonical sequence as follows:
1-238: Missing.
10 20 30 40 50
MRIQNEGAGK SSWWVINPDA KPGRNPRRTR ERSNTIETTT KAQLEKSRRG
60 70 80 90 100
AKKRIKERAL MGSLHSTLNG NSIAGSIQTI SHDLYDDDSM QGAFDNVPSS
110 120 130 140 150
FRPRTQSNLS IPGSSSRVSP AIGSDIYDDL EFPSWVGESV PAIPSDIVDR
160 170 180 190 200
TDQMRIDATT HIGGVQIKQE SKPIKTEPIA PPPSYHELNS VRGSCAQNPL
210 220 230 240 250
LRNPIVPSTN FKPMPLPGAY GNYQNGGITP INWLSTSNSS PLPGIQSCGI
260 270 280 290 300
VAAQHTVASS SALPIDLENL TLPDQPLMDT MDVDALIRHE LSQAGGQHIH
FDL
Note: No experimental confirmation available. Derived from EST data.Curated
Show »Length:303
Mass (Da):32,933
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iDD1DEB2F8E1BCCAD
Isoform f1 Publication
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.3"Genome sequence of the nematode C. elegans: a platform for investigating biology."
The C. elegans sequencing consortium
Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
The sequence of this isoform differs from the canonical sequence as follows:
1-24: Missing.
10 20 30 40 50
MQAWNCRELD SPLPSDITLH NLEPARPDSG MSFSTDFDDD FFNLDLHQQE
60 70 80 90 100
RSASFGGVTQ YSQQFLREKC SFSPYFHTSL ETVDSGRTSL YGSNEQCGQL
110 120 130 140 150
GGASSNGSTA MLHTPDGSNS HQTSFPSDFR MSESPDDTVS GKKTTTRRNA
160 170 180 190 200
WGNMSYAELI TTAIMASPEK RLTLAQVYEW MVQNVPYFRD KGDSNSSAGW
210 220 230 240 250
KNSIRHNLSL HSRFMRIQNE GAGKSSWWVI NPDAKPGRNP RRTRERSNTI
260 270 280 290 300
ETTTKAQLEK SRRGAKKRIK ERALMGSLHS TLNGNSIAGS IQTISHDLYD
310 320 330 340 350
DDSMQGAFDN VPSSFRPRTQ SNLSIPGSSS RVSPAIGSDI YDDLEFPSWV
360 370 380 390 400
GESVPAIPSD IVDRTDQMRI DATTHIGGVQ IKQESKPIKT EPIAPPPSYH
410 420 430 440 450
ELNSVRGSCA QNPLLRNPIV PSTNFKPMPL PGAYGNYQNG GITPINWLST
460 470 480 490 500
SNSSPLPGIQ SCGIVAAQHT VASSSALPID LENLTLPDQP LMDTMDVDAL
510
IRHELSQAGG QHIHFDL
Note: No experimental confirmation available.Curated
Show »Length:517
Mass (Da):56,864
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i884488D4F43DB8D5
Isoform gCurated (identifier: O16850-7) [UniParc]FASTAAdd to basketAdded to basket
The sequence of this isoform differs from the canonical sequence as follows:
1-217: Missing.
218-225: SNSSAGWK → MREMSTKN
10 20 30 40 50
MREMSTKNNS IRHNLSLHSR FMRIQNEGAG KSSWWVINPD AKPGRNPRRT
60 70 80 90 100
RERSNTIETT TKAQLEKSRR GAKKRIKERA LMGSLHSTLN GNSIAGSIQT
110 120 130 140 150
ISHDLYDDDS MQGAFDNVPS SFRPRTQSNL SIPGSSSRVS PAIGSDIYDD
160 170 180 190 200
LEFPSWVGES VPAIPSDIVD RTDQMRIDAT THIGGVQIKQ ESKPIKTEPI
210 220 230 240 250
APPPSYHELN SVRGSCAQNP LLRNPIVPST NFKPMPLPGA YGNYQNGGIT
260 270 280 290 300
PINWLSTSNS SPLPGIQSCG IVAAQHTVAS SSALPIDLEN LTLPDQPLMD
310 320
TMDVDALIRH ELSQAGGQHI HFDL
Note: No experimental confirmation available.Curated
Show »Length:324
Mass (Da):35,474
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iB1E79F5EB916A3C3
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053105 | 1 – 238 | Missing in isoform e. CuratedAdd BLAST | 238 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053106 | 1 – 221 | MQLEQ…DSNSS → MNDSIDDDFPPEPRGRCYTW PMQQYIYQESSATIPHHHLN QHNNPYHPMHPHHQLPHMQQ LPQPLLNLNMTTLTSSGSSV ASSIGGGAQCSPCASGSSTA ATNSSQQQQTVGQMLAASVP CSSSGMTLGMSLNLSQGGGP MPAKKKRCRKKPTDQLAQKK PNPWGEESYSDIIAKALESA PDGRLKLNEIYQWFSDNIPY FGERSSPEEA in isoform a. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 221 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042147 | 1 – 217 | Missing in isoform g. CuratedAdd BLAST | 217 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053107 | 1 – 113 | MQLEQ…SGRTS → MMEMLVDQGTDASSSASTST SSVSRFGADTFMNTPDDVMM NDDMEPIPRDRCNTWPMRRP QLEPPLNSSPIIHEQIPEED AD in isoform b and isoform c. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 113 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053108 | 1 – 54 | Missing in isoform d. CuratedAdd BLAST | 54 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042148 | 1 – 24 | Missing in isoform f. CuratedAdd BLAST | 24 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_053109 | 152 – 154 | DFR → E in isoform b. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 3 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042149 | 218 – 225 | SNSSAGWK → MREMSTKN in isoform g. Curated | 8 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AF020342 mRNA Translation: AAB84390.1 AF020343 mRNA Translation: AAB84391.1 AF020344 mRNA Translation: AAB84392.1 AF032112 mRNA Translation: AAC47803.1 FO081472 Genomic DNA Translation: CCD71850.1 FO081472 Genomic DNA Translation: CCD71851.1 FO081472 Genomic DNA Translation: CCD71852.1 FO081472 Genomic DNA Translation: CCD71853.1 FO081472 Genomic DNA Translation: CCD71854.1 FO081472, FO080113 Genomic DNA Translation: CCD71855.1 FO081472, FO080113 Genomic DNA Translation: CCD71856.1 FO081472, FO080113 Genomic DNA Translation: CCD71857.1 |
Protein sequence database of the Protein Information Resource More...PIRi | T42234 T42255 |
NCBI Reference Sequences More...RefSeqi | NP_001021593.1, NM_001026422.4 [O16850-2] NP_001021594.1, NM_001026423.4 [O16850-4] NP_001021595.1, NM_001026424.4 NP_001021596.1, NM_001026425.3 [O16850-5] NP_001021597.1, NM_001026426.2 [O16850-6] NP_001021598.2, NM_001026427.4 [O16850-1] NP_001251490.1, NM_001264561.1 [O16850-8] NP_001251492.1, NM_001264563.1 [O16850-7] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Cel.18378 |
Genome annotation databases
Ensembl metazoan genome annotation project More...EnsemblMetazoai | R13H8.1h; R13H8.1h; WBGene00000912 [O16850-8] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 172981 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | cel:CELE_R13H8.1 |
UCSC genome browser More...UCSCi | R13H8.1c c. elegans |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| O16850 | Uncharacterized protein | 407 | |||
| O16850-1 | 517 | ||||
| O16850-6 | 303 | ||||
| O16850-5 | 487 | ||||
| Uncharacterized protein | 515 | ||||
| +2 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| O16850 | Uncharacterized protein | 407 | |||
| Uncharacterized protein | 674 | ||||
| DAF-16 transcription factor (Fragment) | 48 | ||||
| CRE-DAF-16 protein | 528 | ||||
| Uncharacterized protein (Fragment) | 541 | ||||
| +15 | |||||
| O16850-2 | Protein CBR-DAF-16 | 497 | |||
| Uncharacterized protein | 86 | ||||
| Uncharacterized protein | 527 | ||||
| O16850-3 | 510 | ||||
| O16850-4 | 508 | ||||
| O16850-4 | Protein CBR-DAF-16 | 497 | |||
| Uncharacterized protein | 86 | ||||
| Uncharacterized protein | 527 | ||||
| O16850-2 | 530 | ||||
| O16850-3 | 510 | ||||
| O16850-3 | Protein CBR-DAF-16 | 497 | |||
| Uncharacterized protein | 86 | ||||
| Uncharacterized protein | 527 | ||||
| O16850-2 | 530 | ||||
| O16850-4 | 508 | ||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AF020342 mRNA Translation: AAB84390.1 AF020343 mRNA Translation: AAB84391.1 AF020344 mRNA Translation: AAB84392.1 AF032112 mRNA Translation: AAC47803.1 FO081472 Genomic DNA Translation: CCD71850.1 FO081472 Genomic DNA Translation: CCD71851.1 FO081472 Genomic DNA Translation: CCD71852.1 FO081472 Genomic DNA Translation: CCD71853.1 FO081472 Genomic DNA Translation: CCD71854.1 FO081472, FO080113 Genomic DNA Translation: CCD71855.1 FO081472, FO080113 Genomic DNA Translation: CCD71856.1 FO081472, FO080113 Genomic DNA Translation: CCD71857.1 |
Protein sequence database of the Protein Information Resource More...PIRi | T42234 T42255 |
NCBI Reference Sequences More...RefSeqi | NP_001021593.1, NM_001026422.4 [O16850-2] NP_001021594.1, NM_001026423.4 [O16850-4] NP_001021595.1, NM_001026424.4 NP_001021596.1, NM_001026425.3 [O16850-5] NP_001021597.1, NM_001026426.2 [O16850-6] NP_001021598.2, NM_001026427.4 [O16850-1] NP_001251490.1, NM_001264561.1 [O16850-8] NP_001251492.1, NM_001264563.1 [O16850-7] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Cel.18378 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | O16850 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | O16850 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 38392, 5 interactors |
Database of interacting proteins More...DIPi | DIP-25581N |
Protein interaction database and analysis system More...IntActi | O16850, 23 interactors |
STRING: functional protein association networks More...STRINGi | 6239.R13H8.1h |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | O16850 |
Proteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | O16850 |
PeptideAtlas More...PeptideAtlasi | O16850 |
PRoteomics IDEntifications database More...PRIDEi | O16850 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl metazoan genome annotation project More...EnsemblMetazoai | R13H8.1h; R13H8.1h; WBGene00000912 [O16850-8] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 172981 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | cel:CELE_R13H8.1 |
UCSC genome browser More...UCSCi | R13H8.1c c. elegans |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 172981 |
WormBase More...WormBasei | R13H8.1a ; CE28771 ; WBGene00000912 ; daf-16 R13H8.1b ; CE28772 ; WBGene00000912 ; daf-16 R13H8.1c ; CE28773 ; WBGene00000912 ; daf-16 R13H8.1d ; CE38722 ; WBGene00000912 ; daf-16 R13H8.1e ; CE33160 ; WBGene00000912 ; daf-16 R13H8.1f ; CE44821 ; WBGene00000912 ; daf-16 R13H8.1g ; CE44935 ; WBGene00000912 ; daf-16 R13H8.1h ; CE45185 ; WBGene00000912 ; daf-16 |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG2294 Eukaryota COG5025 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00920000149005 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000019698 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | O16850 |
KEGG Orthology (KO) More...KOi | K09408 |
Identification of Orthologs from Complete Genome Data More...OMAi | SASSGNC |
Database of Orthologous Groups More...OrthoDBi | EOG091G06K3 |
Enzyme and pathway databases
Reactome - a knowledgebase of biological pathways and processes More...Reactomei | R-CEL-198693 AKT phosphorylates targets in the nucleus R-CEL-211163 AKT-mediated inactivation of FOXO1A R-CEL-5687128 MAPK6/MAPK4 signaling |
SignaLink: a signaling pathway resource with multi-layered regulatory networks More...SignaLinki | O16850 |
Miscellaneous databases
Protein Ontology More...PROi | PR:O16850 |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | WBGene00000912 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | O16850 baseline and differential |
Family and domain databases
Conserved Domains Database More...CDDi | cd00059 FH, 1 hit |
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.10.10.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR001766 Fork_head_dom IPR030456 TF_fork_head_CS_2 IPR036388 WH-like_DNA-bd_sf IPR036390 WH_DNA-bd_sf |
Pfam protein domain database More...Pfami | View protein in Pfam PF00250 Forkhead, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00053 FORKHEAD |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00339 FH, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46785 SSF46785, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS00658 FORK_HEAD_2, 1 hit PS50039 FORK_HEAD_3, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | FOXO_CAEEL | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | O16850Primary (citable) accession number: O16850 Secondary accession number(s): F3NWW7 , F3NWX0, G4RQR7, G4S686, G4SKG3, G4SKH0, O16849, O18676, Q86S42 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | June 16, 2009 |
| Last sequence update: | January 25, 2012 | |
| Last modified: | June 20, 2018 | |
| This is version 154 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Caenorhabditis annotation project | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Reference proteomeDocuments
- Caenorhabditis elegans
Caenorhabditis elegans: entries, gene names and cross-references to WormBase
