Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fatty acid-binding protein, brain

Gene

FABP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).By similarity

GO - Molecular functioni

  • lipid binding Source: ProtInc

GO - Biological processi

  • cell proliferation in forebrain Source: Ensembl
  • epithelial cell proliferation Source: Ensembl
  • negative regulation of cell proliferation Source: ProtInc
  • nervous system development Source: ProtInc
  • neurogenesis Source: Ensembl
  • prepulse inhibition Source: Ensembl
  • triglyceride catabolic process Source: Reactome

Keywordsi

Biological processTransport
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-163560 Triglyceride catabolism
R-HSA-9013508 NOTCH3 Intracellular Domain Regulates Transcription
SIGNORiO15540

Chemistry databases

SwissLipidsiSLP:000000498

Names & Taxonomyi

Protein namesi
Recommended name:
Fatty acid-binding protein, brain
Alternative name(s):
Brain lipid-binding protein
Short name:
BLBP
Brain-type fatty acid-binding protein
Short name:
B-FABP
Fatty acid-binding protein 7
Mammary-derived growth inhibitor related
Gene namesi
Name:FABP7
Synonyms:BLBP, FABPB, MRG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000164434.11
HGNCiHGNC:3562 FABP7
MIMi602965 gene
neXtProtiNX_O15540

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi2173
OpenTargetsiENSG00000164434
PharmGKBiPA27963

Chemistry databases

ChEMBLiCHEMBL3826863
DrugBankiDB00132 Alpha-Linolenic Acid
DB00154 Dihomo-gamma-linolenic acid
DB00159 Icosapent
DB04224 Oleic Acid

Polymorphism and mutation databases

BioMutaiFABP7

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000673732 – 132Fatty acid-binding protein, brainAdd BLAST131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylvalineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiO15540
PaxDbiO15540
PeptideAtlasiO15540
PRIDEiO15540
ProteomicsDBi48748

2D gel databases

DOSAC-COBS-2DPAGEiO15540

PTM databases

iPTMnetiO15540
PhosphoSitePlusiO15540

Expressioni

Tissue specificityi

Expressed in brain and other neural tissues.

Gene expression databases

BgeeiENSG00000164434
CleanExiHS_FABP7
GenevisibleiO15540 HS

Organism-specific databases

HPAiCAB025488
CAB058697
HPA028825

Interactioni

Protein-protein interaction databases

BioGridi108471, 10 interactors
IntActiO15540, 1 interactor
STRINGi9606.ENSP00000357429

Structurei

Secondary structure

1132
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 5Combined sources3
Beta strandi7 – 16Combined sources10
Helixi17 – 24Combined sources8
Helixi28 – 36Combined sources9
Beta strandi40 – 46Combined sources7
Beta strandi49 – 55Combined sources7
Beta strandi61 – 65Combined sources5
Beta strandi71 – 74Combined sources4
Turni76 – 78Combined sources3
Beta strandi80 – 88Combined sources9
Beta strandi91 – 98Combined sources8
Beta strandi101 – 110Combined sources10
Beta strandi113 – 120Combined sources8
Beta strandi123 – 131Combined sources9

3D structure databases

ProteinModelPortaliO15540
SMRiO15540
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15540

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni127 – 129Fatty acid binding3

Domaini

Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00760000118898
HOGENOMiHOG000004829
HOVERGENiHBG005633
InParanoidiO15540
KOiK08756
OMAiVCTRIYK
OrthoDBiEOG091G0QSV
PhylomeDBiO15540
TreeFamiTF316894

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR000463 Fatty_acid-bd
IPR031259 ILBP
IPR000566 Lipocln_cytosolic_FA-bd_dom
PANTHERiPTHR11955 PTHR11955, 1 hit
PfamiView protein in Pfam
PF00061 Lipocalin, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15540-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVEAFCATWK LTNSQNFDEY MKALGVGFAT RQVGNVTKPT VIISQEGDKV
60 70 80 90 100
VIRTLSTFKN TEISFQLGEE FDETTADDRN CKSVVSLDGD KLVHIQKWDG
110 120 130
KETNFVREIK DGKMVMTLTF GDVVAVRHYE KA
Length:132
Mass (Da):14,889
Last modified:January 23, 2007 - v3
Checksum:iF1E8EE12B9474B97
GO
Isoform 2 (identifier: O15540-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-132: TLTFGDVVAVRHYEKA → VSNDNSPFFLVFFSSPHTSHLLPSSSLLLPFFLLPSFFNNTSLARFFNYM

Show »
Length:166
Mass (Da):18,829
Checksum:i4E88C1139530F07A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti60N → D in BAA23324 (Ref. 4) Curated1
Sequence conflicti110K → R in CAG33338 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04901261T → M. Corresponds to variant dbSNP:rs2279381Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055490117 – 132TLTFG…HYEKA → VSNDNSPFFLVFFSSPHTSH LLPSSSLLLPFFLLPSFFNN TSLARFFNYM in isoform 2. 2 PublicationsAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002962 mRNA Translation: CAA05773.1
D88648 mRNA Translation: BAA23645.1
U51338 mRNA Translation: AAB87141.1
D50373 mRNA Translation: BAA23324.1
U81235 mRNA Translation: AAD00507.1
CR457057 mRNA Translation: CAG33338.1
AK289836 mRNA Translation: BAF82525.1
AK311867 mRNA Translation: BAG34808.1
AL512688 mRNA Translation: CAC21646.1
AL645811 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48166.1
CH471051 Genomic DNA Translation: EAW48167.1
BC012299 mRNA Translation: AAH12299.1
CCDSiCCDS5127.1 [O15540-1]
CCDS83121.1 [O15540-2]
RefSeqiNP_001305968.1, NM_001319039.1 [O15540-2]
NP_001437.1, NM_001446.4 [O15540-1]
UniGeneiHs.26770

Genome annotation databases

EnsembliENST00000356535; ENSP00000348931; ENSG00000164434 [O15540-2]
ENST00000368444; ENSP00000357429; ENSG00000164434 [O15540-1]
GeneIDi2173
KEGGihsa:2173
UCSCiuc003pzd.4 human [O15540-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFABP7_HUMAN
AccessioniPrimary (citable) accession number: O15540
Secondary accession number(s): B2R4L1
, O14951, Q6IAU7, Q9H047
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 23, 2007
Last modified: June 20, 2018
This is version 160 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health