Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fatty acid-binding protein, brain

Gene

FABP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • lipid binding Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport
LigandLipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-163560 Triglyceride catabolism
R-HSA-9013508 NOTCH3 Intracellular Domain Regulates Transcription

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15540

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000498

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fatty acid-binding protein, brain
Alternative name(s):
Brain lipid-binding protein
Short name:
BLBP
Brain-type fatty acid-binding protein
Short name:
B-FABP
Fatty acid-binding protein 7
Mammary-derived growth inhibitor related
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FABP7
Synonyms:BLBP, FABPB, MRG
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164434.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3562 FABP7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602965 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15540

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2173

Open Targets

More...
OpenTargetsi
ENSG00000164434

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27963

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3826863

Drug and drug target database

More...
DrugBanki
DB00132 Alpha-Linolenic Acid
DB00154 Dihomo-gamma-linolenic acid
DB00159 Icosapent
DB04224 Oleic Acid

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FABP7

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000673732 – 132Fatty acid-binding protein, brainAdd BLAST131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylvalineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15540

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15540

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15540

PeptideAtlas

More...
PeptideAtlasi
O15540

PRoteomics IDEntifications database

More...
PRIDEi
O15540

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48748

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
O15540

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15540

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15540

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and other neural tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164434 Expressed in 141 organ(s), highest expression level in neocortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_FABP7

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15540 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025488
CAB058697
HPA028825

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108471, 10 interactors

Protein interaction database and analysis system

More...
IntActi
O15540, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357429

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1132
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FDQX-ray2.10A/B2-132[»]
1FE3X-ray2.80A2-132[»]
1JJXNMR-A2-132[»]
5URAX-ray1.85A/B/C/D1-132[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15540

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15540

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O15540

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni127 – 129Fatty acid binding3

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4015 Eukaryota
ENOG4111US8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156713

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000004829

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005633

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15540

KEGG Orthology (KO)

More...
KOi
K08756

Identification of Orthologs from Complete Genome Data

More...
OMAi
WKLTESQ

Database of Orthologous Groups

More...
OrthoDBi
1417203at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15540

TreeFam database of animal gene trees

More...
TreeFami
TF316894

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.128.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012674 Calycin
IPR000463 Fatty_acid-bd
IPR031259 ILBP
IPR000566 Lipocln_cytosolic_FA-bd_dom

The PANTHER Classification System

More...
PANTHERi
PTHR11955 PTHR11955, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00061 Lipocalin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00178 FATTYACIDBP

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50814 SSF50814, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00214 FABP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: O15540-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVEAFCATWK LTNSQNFDEY MKALGVGFAT RQVGNVTKPT VIISQEGDKV
60 70 80 90 100
VIRTLSTFKN TEISFQLGEE FDETTADDRN CKSVVSLDGD KLVHIQKWDG
110 120 130
KETNFVREIK DGKMVMTLTF GDVVAVRHYE KA
Length:132
Mass (Da):14,889
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF1E8EE12B9474B97
GO
Isoform 2 (identifier: O15540-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-132: TLTFGDVVAVRHYEKA → VSNDNSPFFLVFFSSPHTSHLLPSSSLLLPFFLLPSFFNNTSLARFFNYM

Show »
Length:166
Mass (Da):18,829
Checksum:i4E88C1139530F07A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti60N → D in BAA23324 (Ref. 4) Curated1
Sequence conflicti110K → R in CAG33338 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04901261T → M. Corresponds to variant dbSNP:rs2279381Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_055490117 – 132TLTFG…HYEKA → VSNDNSPFFLVFFSSPHTSH LLPSSSLLLPFFLLPSFFNN TSLARFFNYM in isoform 2. 2 PublicationsAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ002962 mRNA Translation: CAA05773.1
D88648 mRNA Translation: BAA23645.1
U51338 mRNA Translation: AAB87141.1
D50373 mRNA Translation: BAA23324.1
U81235 mRNA Translation: AAD00507.1
CR457057 mRNA Translation: CAG33338.1
AK289836 mRNA Translation: BAF82525.1
AK311867 mRNA Translation: BAG34808.1
AL512688 mRNA Translation: CAC21646.1
AL645811 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48166.1
CH471051 Genomic DNA Translation: EAW48167.1
BC012299 mRNA Translation: AAH12299.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5127.1 [O15540-1]
CCDS83121.1 [O15540-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001305968.1, NM_001319039.1 [O15540-2]
NP_001437.1, NM_001446.4 [O15540-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.26770

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356535; ENSP00000348931; ENSG00000164434 [O15540-2]
ENST00000368444; ENSP00000357429; ENSG00000164434 [O15540-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2173

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2173

UCSC genome browser

More...
UCSCi
uc003pzd.4 human [O15540-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ002962 mRNA Translation: CAA05773.1
D88648 mRNA Translation: BAA23645.1
U51338 mRNA Translation: AAB87141.1
D50373 mRNA Translation: BAA23324.1
U81235 mRNA Translation: AAD00507.1
CR457057 mRNA Translation: CAG33338.1
AK289836 mRNA Translation: BAF82525.1
AK311867 mRNA Translation: BAG34808.1
AL512688 mRNA Translation: CAC21646.1
AL645811 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW48166.1
CH471051 Genomic DNA Translation: EAW48167.1
BC012299 mRNA Translation: AAH12299.1
CCDSiCCDS5127.1 [O15540-1]
CCDS83121.1 [O15540-2]
RefSeqiNP_001305968.1, NM_001319039.1 [O15540-2]
NP_001437.1, NM_001446.4 [O15540-1]
UniGeneiHs.26770

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1FDQX-ray2.10A/B2-132[»]
1FE3X-ray2.80A2-132[»]
1JJXNMR-A2-132[»]
5URAX-ray1.85A/B/C/D1-132[»]
ProteinModelPortaliO15540
SMRiO15540
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108471, 10 interactors
IntActiO15540, 1 interactor
STRINGi9606.ENSP00000357429

Chemistry databases

ChEMBLiCHEMBL3826863
DrugBankiDB00132 Alpha-Linolenic Acid
DB00154 Dihomo-gamma-linolenic acid
DB00159 Icosapent
DB04224 Oleic Acid
SwissLipidsiSLP:000000498

PTM databases

iPTMnetiO15540
PhosphoSitePlusiO15540

Polymorphism and mutation databases

BioMutaiFABP7

2D gel databases

DOSAC-COBS-2DPAGEiO15540

Proteomic databases

EPDiO15540
jPOSTiO15540
PaxDbiO15540
PeptideAtlasiO15540
PRIDEiO15540
ProteomicsDBi48748

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2173
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356535; ENSP00000348931; ENSG00000164434 [O15540-2]
ENST00000368444; ENSP00000357429; ENSG00000164434 [O15540-1]
GeneIDi2173
KEGGihsa:2173
UCSCiuc003pzd.4 human [O15540-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2173
DisGeNETi2173
EuPathDBiHostDB:ENSG00000164434.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FABP7
HGNCiHGNC:3562 FABP7
HPAiCAB025488
CAB058697
HPA028825
MIMi602965 gene
neXtProtiNX_O15540
OpenTargetsiENSG00000164434
PharmGKBiPA27963

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4015 Eukaryota
ENOG4111US8 LUCA
GeneTreeiENSGT00940000156713
HOGENOMiHOG000004829
HOVERGENiHBG005633
InParanoidiO15540
KOiK08756
OMAiWKLTESQ
OrthoDBi1417203at2759
PhylomeDBiO15540
TreeFamiTF316894

Enzyme and pathway databases

ReactomeiR-HSA-163560 Triglyceride catabolism
R-HSA-9013508 NOTCH3 Intracellular Domain Regulates Transcription
SIGNORiO15540

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FABP7 human
EvolutionaryTraceiO15540

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FABP7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2173

Protein Ontology

More...
PROi
PR:O15540

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164434 Expressed in 141 organ(s), highest expression level in neocortex
CleanExiHS_FABP7
GenevisibleiO15540 HS

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR000463 Fatty_acid-bd
IPR031259 ILBP
IPR000566 Lipocln_cytosolic_FA-bd_dom
PANTHERiPTHR11955 PTHR11955, 1 hit
PfamiView protein in Pfam
PF00061 Lipocalin, 1 hit
PRINTSiPR00178 FATTYACIDBP
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00214 FABP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFABP7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15540
Secondary accession number(s): B2R4L1
, O14951, Q6IAU7, Q9H047
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 23, 2007
Last modified: January 16, 2019
This is version 164 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again