Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15535 (ZSC9_HUMAN)

Protein

Zinc finger and SCAN domain-containing protein 9

Gene

ZSCAN9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri254 – 276C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri282 – 304C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri310 – 332C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri338 – 360C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri366 – 388C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 9
Alternative name(s):
Cell proliferation-inducing gene 12 protein
PRD51
Zinc finger protein 193
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZSCAN9
Synonyms:ZNF193
ORF Names:PIG12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000137185.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:12984 ZSCAN9

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602246 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15535

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000137185

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA37564

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZSCAN9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000474461 – 394Zinc finger and SCAN domain-containing protein 9Add BLAST394

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki26Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki238Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		O15535

PeptideAtlas

More...PeptideAtlasi		O15535

PRoteomics IDEntifications database

More...PRIDEi		O15535

ProteomicsDB human proteome resource

More...ProteomicsDBi		48744

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15535

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15535

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000137185 Expressed in 170 organ(s), highest expression level in small intestine Peyer's patch

CleanEx database of gene expression profiles

More...CleanExi		HS_ZNF193

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O15535 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15535 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA054512
HPA059951

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		113530, 10 interactors

Protein interaction database and analysis system

More...IntActi		O15535, 13 interactors

Molecular INTeraction database

More...MINTi		O15535

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		O15535

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15535

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 134SCAN boxPROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri254 – 276C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri282 – 304C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri310 – 332C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri338 – 360C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri366 – 388C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000163521

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000234619

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG018163

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15535

KEGG Orthology (KO)

More...KOi		K09230

Identification of Orthologs from Complete Genome Data

More...OMAi		HEMVAYR

Database of Orthologous Groups

More...OrthoDBi		EOG091G09O3

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15535

TreeFam database of animal gene trees

More...TreeFami		TF338304

Family and domain databases

Conserved Domains Database

More...CDDi		cd07936 SCAN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.4020.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15535-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTNSKEVLS LGVQVPEAWE ELLTMKVEAK SHLQWQESRL KRSNPLAREI 
        60         70         80         90        100
FRRHFRQLCY QETPGPREAL TRLQELCYQW LRPHVSTKEQ ILDLLVLEQF 
       110        120        130        140        150
LSILPKELQG WVREHCPESG EEAVILLEDL ERELDEPQHE MVAHRHRQEV 
       160        170        180        190        200
LCKEMVPLAE QTPLTLQSQP KEPQLTCDSA QKCHSIGETD EVTKTEDREL 
       210        220        230        240        250
VLRKDCPKIV EPHGKMFNEQ TWEVSQQDPS HGEVGEHKDR IERQWGNLLG 
       260        270        280        290        300
EGQHKCDECG KSFTQSSGLI RHQRIHTGER PYECNECGKA FSRSSGLFNH 
       310        320        330        340        350
RGIHNIQKRY HCKECGKVFS QSAGLIQHQR IHKGEKPYQC SQCSKSYSRR 
       360        370        380        390 
SFLIEHQRSH TGERPHQCIE CGKSFNRHCN LIRHQKIHTV AELV
Length:394
Mass (Da):45,954
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CEC2BBC3E39EA40
GO
Isoform 2 (identifier: O15535-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-189: T → TDLIRSLRRRAVLIPLGAHLFSTDTFLFSKPVVIPQLKGGGETWPNNRGVLR

Note: No experimental confirmation available.
Show »
Length:445
Mass (Da):51,650
Checksum:i8D955B1226963018
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQL7E9PQL7_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
369Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQV4U3KQV4_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J224A0A0B4J224_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQB2U3KQB2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLJ4E9PLJ4_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7E → G in BAG64928 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_076868254H → R1 PublicationCorresponds to variant dbSNP:rs148219046Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044798189T → TDLIRSLRRRAVLIPLGAHL FSTDTFLFSKPVVIPQLKGG GETWPNNRGVLR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U62392 mRNA Translation: AAC51659.1
U88082, U88081 Genomic DNA Translation: AAC51661.1
AK304013 mRNA Translation: BAG64928.1
AY550973 mRNA Translation: AAT52219.1
AL022393 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03140.1
BC010374 mRNA Translation: AAH10374.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4646.1 [O15535-1]
CCDS56407.1 [O15535-2]

NCBI Reference Sequences

More...RefSeqi		NP_001186408.1, NM_001199479.1 [O15535-2]
NP_001186409.1, NM_001199480.1 [O15535-1]
NP_006290.1, NM_006299.4 [O15535-1]
XP_016866756.1, XM_017011267.1 [O15535-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.100921
Hs.731936

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000252207; ENSP00000252207; ENSG00000137185 [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185 [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185 [O15535-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7746

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7746

UCSC genome browser

More...UCSCi		uc003nkq.3 human [O15535-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62392 mRNA Translation: AAC51659.1
U88082, U88081 Genomic DNA Translation: AAC51661.1
AK304013 mRNA Translation: BAG64928.1
AY550973 mRNA Translation: AAT52219.1
AL022393 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03140.1
BC010374 mRNA Translation: AAH10374.1
CCDSiCCDS4646.1 [O15535-1]
CCDS56407.1 [O15535-2]
RefSeqiNP_001186408.1, NM_001199479.1 [O15535-2]
NP_001186409.1, NM_001199480.1 [O15535-1]
NP_006290.1, NM_006299.4 [O15535-1]
XP_016866756.1, XM_017011267.1 [O15535-1]
UniGeneiHs.100921
Hs.731936

3D structure databases

ProteinModelPortaliO15535
SMRiO15535
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113530, 10 interactors
IntActiO15535, 13 interactors
MINTiO15535

PTM databases

iPTMnetiO15535
PhosphoSitePlusiO15535

Polymorphism and mutation databases

BioMutaiZSCAN9

Proteomic databases

MaxQBiO15535
PeptideAtlasiO15535
PRIDEiO15535
ProteomicsDBi48744

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		7746
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252207; ENSP00000252207; ENSG00000137185 [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185 [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185 [O15535-1]
GeneIDi7746
KEGGihsa:7746
UCSCiuc003nkq.3 human [O15535-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7746
EuPathDBiHostDB:ENSG00000137185.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZSCAN9
HGNCiHGNC:12984 ZSCAN9
HPAiHPA054512
HPA059951
MIMi602246 gene
neXtProtiNX_O15535
OpenTargetsiENSG00000137185
PharmGKBiPA37564

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000163521
HOGENOMiHOG000234619
HOVERGENiHBG018163
InParanoidiO15535
KOiK09230
OMAiHEMVAYR
OrthoDBiEOG091G09O3
PhylomeDBiO15535
TreeFamiTF338304

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ZNF193

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7746

Protein Ontology

More...PROi		PR:O15535

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000137185 Expressed in 170 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_ZNF193
ExpressionAtlasiO15535 baseline and differential
GenevisibleiO15535 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 5 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZSC9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15535
Secondary accession number(s): B4E1W6, E7EVQ2, Q2TTR1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: December 5, 2018
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again