Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger and SCAN domain-containing protein 9

Gene

ZSCAN9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri254 – 276C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri282 – 304C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri310 – 332C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri338 – 360C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri366 – 388C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger and SCAN domain-containing protein 9
Alternative name(s):
Cell proliferation-inducing gene 12 protein
PRD51
Zinc finger protein 193
Gene namesi
Name:ZSCAN9
Synonyms:ZNF193
ORF Names:PIG12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000137185.11
HGNCiHGNC:12984 ZSCAN9
MIMi602246 gene
neXtProtiNX_O15535

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000137185
PharmGKBiPA37564

Polymorphism and mutation databases

BioMutaiZSCAN9

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000474461 – 394Zinc finger and SCAN domain-containing protein 9Add BLAST394

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki26Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki238Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiO15535
PeptideAtlasiO15535
PRIDEiO15535
ProteomicsDBi48744

PTM databases

iPTMnetiO15535
PhosphoSitePlusiO15535

Expressioni

Gene expression databases

BgeeiENSG00000137185 Expressed in 170 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_ZNF193
ExpressionAtlasiO15535 baseline and differential
GenevisibleiO15535 HS

Organism-specific databases

HPAiHPA054512
HPA059951

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi113530, 10 interactors
IntActiO15535, 13 interactors
MINTiO15535

Structurei

3D structure databases

ProteinModelPortaliO15535
SMRiO15535
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 134SCAN boxPROSITE-ProRule annotationAdd BLAST83

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri254 – 276C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri282 – 304C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri310 – 332C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri338 – 360C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri366 – 388C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

GeneTreeiENSGT00760000118881
HOGENOMiHOG000234619
HOVERGENiHBG018163
InParanoidiO15535
KOiK09230
OMAiVEPHGKM
OrthoDBiEOG091G09O3
PhylomeDBiO15535
TreeFamiTF338304

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 5 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15535-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTNSKEVLS LGVQVPEAWE ELLTMKVEAK SHLQWQESRL KRSNPLAREI
60 70 80 90 100
FRRHFRQLCY QETPGPREAL TRLQELCYQW LRPHVSTKEQ ILDLLVLEQF
110 120 130 140 150
LSILPKELQG WVREHCPESG EEAVILLEDL ERELDEPQHE MVAHRHRQEV
160 170 180 190 200
LCKEMVPLAE QTPLTLQSQP KEPQLTCDSA QKCHSIGETD EVTKTEDREL
210 220 230 240 250
VLRKDCPKIV EPHGKMFNEQ TWEVSQQDPS HGEVGEHKDR IERQWGNLLG
260 270 280 290 300
EGQHKCDECG KSFTQSSGLI RHQRIHTGER PYECNECGKA FSRSSGLFNH
310 320 330 340 350
RGIHNIQKRY HCKECGKVFS QSAGLIQHQR IHKGEKPYQC SQCSKSYSRR
360 370 380 390
SFLIEHQRSH TGERPHQCIE CGKSFNRHCN LIRHQKIHTV AELV
Length:394
Mass (Da):45,954
Last modified:January 1, 1998 - v1
Checksum:i4CEC2BBC3E39EA40
GO
Isoform 2 (identifier: O15535-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-189: T → TDLIRSLRRRAVLIPLGAHLFSTDTFLFSKPVVIPQLKGGGETWPNNRGVLR

Note: No experimental confirmation available.
Show »
Length:445
Mass (Da):51,650
Checksum:i8D955B1226963018
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQL7E9PQL7_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
369Annotation score:
U3KQV4U3KQV4_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
197Annotation score:
A0A0B4J224A0A0B4J224_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
261Annotation score:
U3KQB2U3KQB2_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
160Annotation score:
E9PLJ4E9PLJ4_HUMAN
Zinc finger and SCAN domain-contain...
ZSCAN9
41Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti7E → G in BAG64928 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076868254H → R1 PublicationCorresponds to variant dbSNP:rs148219046Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044798189T → TDLIRSLRRRAVLIPLGAHL FSTDTFLFSKPVVIPQLKGG GETWPNNRGVLR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62392 mRNA Translation: AAC51659.1
U88082, U88081 Genomic DNA Translation: AAC51661.1
AK304013 mRNA Translation: BAG64928.1
AY550973 mRNA Translation: AAT52219.1
AL022393 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03140.1
BC010374 mRNA Translation: AAH10374.1
CCDSiCCDS4646.1 [O15535-1]
CCDS56407.1 [O15535-2]
RefSeqiNP_001186408.1, NM_001199479.1 [O15535-2]
NP_001186409.1, NM_001199480.1 [O15535-1]
NP_006290.1, NM_006299.4 [O15535-1]
XP_016866756.1, XM_017011267.1 [O15535-1]
UniGeneiHs.100921
Hs.731936

Genome annotation databases

EnsembliENST00000252207; ENSP00000252207; ENSG00000137185 [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185 [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185 [O15535-1]
GeneIDi7746
KEGGihsa:7746
UCSCiuc003nkq.3 human [O15535-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62392 mRNA Translation: AAC51659.1
U88082, U88081 Genomic DNA Translation: AAC51661.1
AK304013 mRNA Translation: BAG64928.1
AY550973 mRNA Translation: AAT52219.1
AL022393 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03140.1
BC010374 mRNA Translation: AAH10374.1
CCDSiCCDS4646.1 [O15535-1]
CCDS56407.1 [O15535-2]
RefSeqiNP_001186408.1, NM_001199479.1 [O15535-2]
NP_001186409.1, NM_001199480.1 [O15535-1]
NP_006290.1, NM_006299.4 [O15535-1]
XP_016866756.1, XM_017011267.1 [O15535-1]
UniGeneiHs.100921
Hs.731936

3D structure databases

ProteinModelPortaliO15535
SMRiO15535
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113530, 10 interactors
IntActiO15535, 13 interactors
MINTiO15535

PTM databases

iPTMnetiO15535
PhosphoSitePlusiO15535

Polymorphism and mutation databases

BioMutaiZSCAN9

Proteomic databases

MaxQBiO15535
PeptideAtlasiO15535
PRIDEiO15535
ProteomicsDBi48744

Protocols and materials databases

DNASUi7746
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252207; ENSP00000252207; ENSG00000137185 [O15535-1]
ENST00000425468; ENSP00000404074; ENSG00000137185 [O15535-2]
ENST00000531979; ENSP00000433402; ENSG00000137185 [O15535-1]
GeneIDi7746
KEGGihsa:7746
UCSCiuc003nkq.3 human [O15535-1]

Organism-specific databases

CTDi7746
EuPathDBiHostDB:ENSG00000137185.11
GeneCardsiZSCAN9
HGNCiHGNC:12984 ZSCAN9
HPAiHPA054512
HPA059951
MIMi602246 gene
neXtProtiNX_O15535
OpenTargetsiENSG00000137185
PharmGKBiPA37564
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118881
HOGENOMiHOG000234619
HOVERGENiHBG018163
InParanoidiO15535
KOiK09230
OMAiVEPHGKM
OrthoDBiEOG091G09O3
PhylomeDBiO15535
TreeFamiTF338304

Miscellaneous databases

GeneWikiiZNF193
GenomeRNAii7746
PROiPR:O15535
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137185 Expressed in 170 organ(s), highest expression level in small intestine Peyer's patch
CleanExiHS_ZNF193
ExpressionAtlasiO15535 baseline and differential
GenevisibleiO15535 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 5 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZSC9_HUMAN
AccessioniPrimary (citable) accession number: O15535
Secondary accession number(s): B4E1W6, E7EVQ2, Q2TTR1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: October 10, 2018
This is version 177 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again