Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Period circadian protein homolog 1

Gene

PER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional repressor which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, ARNTL/BMAL1, ARNTL2/BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and ARNTL/BMAL1 or ARNTL2/BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-ARNTL/BMAL1|ARNTL2/BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1/2 and RORA/B/G, which form a second feedback loop and which activate and repress ARNTL/BMAL1 transcription, respectively. Regulates circadian target genes expression at post-transcriptional levels, but may not be required for the repression at transcriptional level. Controls PER2 protein decay. Represses CRY2 preventing its repression on CLOCK/ARNTL target genes such as FXYD5 and SCNN1A in kidney and PPARA in liver. Besides its involvement in the maintenance of the circadian clock, has an important function in the regulation of several processes. Participates in the repression of glucocorticoid receptor NR3C1/GR-induced transcriptional activity by reducing the association of NR3C1/GR to glucocorticoid response elements (GREs) by ARNTL:CLOCK. Plays a role in the modulation of the neuroinflammatory state via the regulation of inflammatory mediators release, such as CCL2 and IL6. In spinal astrocytes, negatively regulates the MAPK14/p38 and MAPK8/JNK MAPK cascades as well as the subsequent activation of NFkappaB. Coordinately regulates the expression of multiple genes that are involved in the regulation of renal sodium reabsorption. Can act as gene expression activator in a gene and tissue specific manner, in kidney enhances WNK1 and SLC12A3 expression in collaboration with CLOCK. Modulates hair follicle cycling. Represses the CLOCK-ARNTL/BMAL1 induced transcription of BHLHE40/DEC1.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processBiological rhythms, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-400253 Circadian Clock
SIGNORiO15534

Names & Taxonomyi

Protein namesi
Recommended name:
Period circadian protein homolog 1
Short name:
hPER1
Alternative name(s):
Circadian clock protein PERIOD 1
Circadian pacemaker protein Rigui
Gene namesi
Name:PER1
Synonyms:KIAA0482, PER, RIGUI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000179094.13
HGNCiHGNC:8845 PER1
MIMi602260 gene
neXtProtiNX_O15534

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi121 – 126TSGCSS → AAGCSA: Strongly decreases interaction with BTRC and FBXW11 and inhibits degradation promoted by CSNK1E. 6
Mutagenesisi210 – 213SEYT → AEYA: No effect on interaction with BTRC and FBXW11. 1 Publication4
Mutagenesisi714 – 726SVVSV…CSFSS → AVVAVTAQCAFAA: No effect on interaction with BTRC and FBXW11. 1 PublicationAdd BLAST13
Mutagenesisi794 – 798FLSRF → ALSRA: Strongly decreases interaction with BTRC and FBXW11. 1 Publication5

Organism-specific databases

DisGeNETi5187
OpenTargetsiENSG00000179094
PharmGKBiPA33184

Polymorphism and mutation databases

BioMutaiPER1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001626271 – 1290Period circadian protein homolog 1Add BLAST1290

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei121Phosphothreonine; by CSNK1ESequence analysis1
Modified residuei122Phosphoserine; by CSNK1ESequence analysis1
Modified residuei126Phosphoserine; by CSNK1ESequence analysis1
Modified residuei661PhosphoserineBy similarity1
Modified residuei663PhosphoserineBy similarity1
Modified residuei704PhosphoserineCombined sources1
Modified residuei815PhosphoserineCombined sources1
Modified residuei979PhosphoserineCombined sources1
Modified residuei980PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on serine residues by CSNK1D, CSNK1E and probably also by CSNK1G2. Phosphorylation by CSNK1D or CSNK1E promotes nuclear location of PER proteins as well as ubiquitination and subsequent degradation. May be dephosphorylated by PP1.1 Publication
Ubiquitinated; requires phosphorylation by CSNK1E and interaction with BTRC and FBXW11. Deubiquitinated by USP2 (By similarity).By similarity1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiO15534
PaxDbiO15534
PeptideAtlasiO15534
PRIDEiO15534
ProteomicsDBi48743

PTM databases

iPTMnetiO15534
PhosphoSitePlusiO15534

Expressioni

Tissue specificityi

Widely expressed. Expressed in hair follicles (at protein level).Found in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, kidney, spleen, thymus, prostate, testis, ovary and small intestine. Highest level in skeletal muscle.4 Publications

Inductioni

Serum-induced levels in fibroblasts show circadian oscillations. Maximum levels after 1 hour stimulation, minimum levels after 12 hours. Another peak is then observed after 20 hours. Protein levels show maximum levels at 6 hours, decrease to reach minimum levels at 20 hours, and increase again to reach a second peak after 26 hours. Levels then decrease slightly and then increase to maximum levels at 32 hours. Levels of phosphorylated form increase between 3 hours and 12 hours.1 Publication

Gene expression databases

BgeeiENSG00000179094 Expressed in 224 organ(s), highest expression level in right adrenal gland
CleanExiHS_PER1
ExpressionAtlasiO15534 baseline and differential
GenevisibleiO15534 HS

Organism-specific databases

HPAiHPA047947
HPA067064

Interactioni

Subunit structurei

Homodimer. Component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, ARNTL/BMAL1 or ARNTL2/BMAL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly with TIMELESS, PER2, PER3 and, through a C-terminal domain, with CRY1 and CRY2. Interacts with ARNTL/BMAL1 and CLOCK. Interacts with GPRASP1. Interacts (phosphorylated) with BTRC and FBXW11; the interactions trigger proteasomal degradation. Interacts with NONO, WDR5 and SFPQ. Interacts with USP2 (By similarity).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Cry2Q9R1943EBI-2557276,EBI-1266619From Mus musculus.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111210, 46 interactors
ComplexPortaliCPX-3221 Cry2-Per1 complex
CPX-3222 Cry1-Per1 complex
DIPiDIP-56603N
IntActiO15534, 10 interactors
MINTiO15534
STRINGi9606.ENSP00000314420

Structurei

3D structure databases

ProteinModelPortaliO15534
SMRiO15534
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini208 – 275PAS 1PROSITE-ProRule annotationAdd BLAST68
Domaini348 – 414PAS 2PROSITE-ProRule annotationAdd BLAST67
Domaini422 – 465PACAdd BLAST44

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 151Interaction with BTRC1 PublicationAdd BLAST151
Regioni596 – 815Required for phosphorylation by CSNK1EBy similarityAdd BLAST220
Regioni1149 – 1290CRY binding domainBy similarityAdd BLAST142

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi138 – 147Nuclear export signal 1By similarity10
Motifi489 – 498Nuclear export signal 2By similarity10
Motifi827 – 843Nuclear localization signalBy similarityAdd BLAST17
Motifi982 – 989Nuclear export signal 3By similarity8
Motifi1043 – 1047LXXLL5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi49 – 129Ser-richAdd BLAST81
Compositional biasi653 – 656Poly-Ser4
Compositional biasi848 – 1013Pro-richAdd BLAST166
Compositional biasi1030 – 1104Ser-richAdd BLAST75
Compositional biasi1269 – 1273Poly-Glu5
Compositional biasi1276 – 1279Poly-Ser4

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IMRF Eukaryota
ENOG410ZBUP LUCA
GeneTreeiENSGT00510000046467
HOGENOMiHOG000231111
HOVERGENiHBG008167
InParanoidiO15534
KOiK21944
OMAiRHHQTPR
OrthoDBiEOG091G00PA
PhylomeDBiO15534
TreeFamiTF318445

Family and domain databases

CDDicd00130 PAS, 1 hit
InterProiView protein in InterPro
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013655 PAS_fold_3
IPR022728 Period_circadian-like_C
PfamiView protein in Pfam
PF08447 PAS_3, 1 hit
PF12114 Period_C, 1 hit
SMARTiView protein in SMART
SM00091 PAS, 2 hits
SUPFAMiSSF55785 SSF55785, 1 hit
PROSITEiView protein in PROSITE
PS50112 PAS, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform Rigui 4.7 (identifier: O15534-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGPLEGADG GGDPRPGESF CPGGVPSPGP PQHRPCPGPS LADDTDANSN
60 70 80 90 100
GSSGNESNGH ESRGASQRSS HSSSSGNGKD SALLETTESS KSTNSQSPSP
110 120 130 140 150
PSSSIAYSLL SASSEQDNPS TSGCSSEQSA RARTQKELMT ALRELKLRLP
160 170 180 190 200
PERRGKGRSG TLATLQYALA CVKQVQANQE YYQQWSLEEG EPCSMDMSTY
210 220 230 240 250
TLEELEHITS EYTLQNQDTF SVAVSFLTGR IVYISEQAAV LLRCKRDVFR
260 270 280 290 300
GTRFSELLAP QDVGVFYGST APSRLPTWGT GASAGSGLRD FTQEKSVFCR
310 320 330 340 350
IRGGPDRDPG PRYQPFRLTP YVTKIRVSDG APAQPCCLLI AERIHSGYEA
360 370 380 390 400
PRIPPDKRIF TTRHTPSCLF QDVDERAAPL LGYLPQDLLG APVLLFLHPE
410 420 430 440 450
DRPLMLAIHK KILQLAGQPF DHSPIRFCAR NGEYVTMDTS WAGFVHPWSR
460 470 480 490 500
KVAFVLGRHK VRTAPLNEDV FTPPAPSPAP SLDTDIQELS EQIHRLLLQP
510 520 530 540 550
VHSPSPTGLC GVGAVTSPGP LHSPGSSSDS NGGDAEGPGP PAPVTFQQIC
560 570 580 590 600
KDVHLVKHQG QQLFIESRAR PQSRPRLPAT GTFKAKALPC QSPDPELEAG
610 620 630 640 650
SAPVQAPLAL VPEEAERKEA SSCSYQQINC LDSILRYLES CNLPSTTKRK
660 670 680 690 700
CASSSSYTTS SASDDDRQRT GPVSVGTKKD PPSAALSGEG ATPRKEPVVG
710 720 730 740 750
GTLSPLALAN KAESVVSVTS QCSFSSTIVH VGDKKPPESD IIMMEDLPGL
760 770 780 790 800
APGPAPSPAP SPTVAPDPAP DAYRPVGLTK AVLSLHTQKE EQAFLSRFRD
810 820 830 840 850
LGRLRGLDSS STAPSALGER GCHHGPAPPS RRHHCRSKAK RSRHHQNPRA
860 870 880 890 900
EAPCYVSHPS PVPPSTPWPT PPATTPFPAV VQPYPLPVFS PRGGPQPLPP
910 920 930 940 950
APTSVPPAAF PAPLVTPMVA LVLPNYLFPT PSSYPYGALQ TPAEGPPTPA
960 970 980 990 1000
SHSPSPSLPA LAPSPPHRPD SPLFNSRCSS PLQLNLLQLE ELPRAEGAAV
1010 1020 1030 1040 1050
AGGPGSSAGP PPPSAEAAEP EARLAEVTES SNQDALSGSS DLLELLLQED
1060 1070 1080 1090 1100
SRSGTGSAAS GSLGSGLGSG SGSGSHEGGS TSASITRSSQ SSHTSKYFGS
1110 1120 1130 1140 1150
IDSSEAEAGA ARGGAEPGDQ VIKYVLQDPI WLLMANADQR VMMTYQVPSR
1160 1170 1180 1190 1200
DMTSVLKQDR ERLRAMQKQQ PRFSEDQRRE LGAVHSWVRK GQLPRALDVM
1210 1220 1230 1240 1250
ACVDCGSSTQ DPGHPDDPLF SELDGLGLEP MEEGGGEQGS SGGGSGEGEG
1260 1270 1280 1290
CEEAQGGAKA SSSQDLAMEE EEEGRSSSSP ALPTAGNCTS
Length:1,290
Mass (Da):136,212
Last modified:December 16, 2008 - v2
Checksum:i60B844468EEF4D1B
GO
Isoform Rigui 3.0 (identifier: O15534-2)
Sequence is not available
Length:
Mass (Da):
Isoform Rigui 6.6 (identifier: O15534-3)
Also known as: Truncated
Sequence is not available
Length:
Mass (Da):
Isoform 2 (identifier: O15534-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQ → MLEVLEEIWSVRARRA
     822-875: CHHGPAPPSR...TPWPTPPATT → SHLGPPGACP...GTGPSLASPH
     876-1290: Missing.

Note: No experimental confirmation available.
Show »
Length:859
Mass (Da):91,644
Checksum:i08F94197E204DEE5
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KRL7J3KRL7_HUMAN
Period circadian protein homolog 1
PER1
1,267Annotation score:
J3QLQ5J3QLQ5_HUMAN
Period circadian protein homolog 1
PER1
112Annotation score:
J3KSL6J3KSL6_HUMAN
Period circadian protein homolog 1
PER1
117Annotation score:
J3QSH9J3QSH9_HUMAN
Period circadian protein homolog 1
PER1 hCG_31279
572Annotation score:
J3KTM2J3KTM2_HUMAN
Period circadian protein homolog 1
PER1
824Annotation score:
J3QL55J3QL55_HUMAN
Period circadian protein homolog 1
PER1
175Annotation score:
J3QL46J3QL46_HUMAN
Period circadian protein homolog 1
PER1
168Annotation score:

Sequence cautioni

The sequence BAC06326 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_079176422H → Q Found in a patient with Moyamoya disease; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1464745710Ensembl.1
Natural variantiVAR_036038696E → Q in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_047899962A → P7 PublicationsCorresponds to variant dbSNP:rs2585405Ensembl.1
Natural variantiVAR_047900968R → H. Corresponds to variant dbSNP:rs3027193Ensembl.1
Natural variantiVAR_036039985N → S in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1323588262Ensembl.1
Natural variantiVAR_0360401060S → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs761958964Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0562051 – 32MSGPL…PGPPQ → MLEVLEEIWSVRARRA in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_056206822 – 875CHHGP…PPATT → SHLGPPGACPLPSLGLDCWG VGLKGGVSAPGTQAGVASTT RPCLGTGPSLASPH in isoform 2. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_056207876 – 1290Missing in isoform 2. 1 PublicationAdd BLAST415

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF022991 mRNA Translation: AAC51765.1
AB002107 mRNA Translation: BAA22633.1
AF102137 Genomic DNA Translation: AAF15544.1
AB030817 Genomic DNA Translation: BAA94085.1
AB088477 mRNA Translation: BAC06326.2 Different initiation.
AK295410 mRNA Translation: BAG58361.1
AC129492 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90090.1
CH471108 Genomic DNA Translation: EAW90091.1
BC137346 mRNA Translation: AAI37347.1
CCDSiCCDS11131.1 [O15534-1]
PIRiT00018
RefSeqiNP_002607.2, NM_002616.2 [O15534-1]
XP_005256746.1, XM_005256689.1 [O15534-1]
UniGeneiHs.445534

Genome annotation databases

EnsembliENST00000317276; ENSP00000314420; ENSG00000179094 [O15534-1]
ENST00000354903; ENSP00000346979; ENSG00000179094 [O15534-4]
GeneIDi5187
KEGGihsa:5187
UCSCiuc002gkd.4 human [O15534-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF022991 mRNA Translation: AAC51765.1
AB002107 mRNA Translation: BAA22633.1
AF102137 Genomic DNA Translation: AAF15544.1
AB030817 Genomic DNA Translation: BAA94085.1
AB088477 mRNA Translation: BAC06326.2 Different initiation.
AK295410 mRNA Translation: BAG58361.1
AC129492 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90090.1
CH471108 Genomic DNA Translation: EAW90091.1
BC137346 mRNA Translation: AAI37347.1
CCDSiCCDS11131.1 [O15534-1]
PIRiT00018
RefSeqiNP_002607.2, NM_002616.2 [O15534-1]
XP_005256746.1, XM_005256689.1 [O15534-1]
UniGeneiHs.445534

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UL6model-A830-845[»]
ProteinModelPortaliO15534
SMRiO15534
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111210, 46 interactors
ComplexPortaliCPX-3221 Cry2-Per1 complex
CPX-3222 Cry1-Per1 complex
DIPiDIP-56603N
IntActiO15534, 10 interactors
MINTiO15534
STRINGi9606.ENSP00000314420

PTM databases

iPTMnetiO15534
PhosphoSitePlusiO15534

Polymorphism and mutation databases

BioMutaiPER1

Proteomic databases

EPDiO15534
PaxDbiO15534
PeptideAtlasiO15534
PRIDEiO15534
ProteomicsDBi48743

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317276; ENSP00000314420; ENSG00000179094 [O15534-1]
ENST00000354903; ENSP00000346979; ENSG00000179094 [O15534-4]
GeneIDi5187
KEGGihsa:5187
UCSCiuc002gkd.4 human [O15534-1]

Organism-specific databases

CTDi5187
DisGeNETi5187
EuPathDBiHostDB:ENSG00000179094.13
GeneCardsiPER1
H-InvDBiHIX0039072
HGNCiHGNC:8845 PER1
HPAiHPA047947
HPA067064
MIMi602260 gene
neXtProtiNX_O15534
OpenTargetsiENSG00000179094
PharmGKBiPA33184
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMRF Eukaryota
ENOG410ZBUP LUCA
GeneTreeiENSGT00510000046467
HOGENOMiHOG000231111
HOVERGENiHBG008167
InParanoidiO15534
KOiK21944
OMAiRHHQTPR
OrthoDBiEOG091G00PA
PhylomeDBiO15534
TreeFamiTF318445

Enzyme and pathway databases

ReactomeiR-HSA-400253 Circadian Clock
SIGNORiO15534

Miscellaneous databases

ChiTaRSiPER1 human
GeneWikiiPER1
GenomeRNAii5187
PROiPR:O15534
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000179094 Expressed in 224 organ(s), highest expression level in right adrenal gland
CleanExiHS_PER1
ExpressionAtlasiO15534 baseline and differential
GenevisibleiO15534 HS

Family and domain databases

CDDicd00130 PAS, 1 hit
InterProiView protein in InterPro
IPR000014 PAS
IPR035965 PAS-like_dom_sf
IPR013655 PAS_fold_3
IPR022728 Period_circadian-like_C
PfamiView protein in Pfam
PF08447 PAS_3, 1 hit
PF12114 Period_C, 1 hit
SMARTiView protein in SMART
SM00091 PAS, 2 hits
SUPFAMiSSF55785 SSF55785, 1 hit
PROSITEiView protein in PROSITE
PS50112 PAS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPER1_HUMAN
AccessioniPrimary (citable) accession number: O15534
Secondary accession number(s): B2RPA8, B4DI49, D3DTR3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: December 16, 2008
Last modified: November 7, 2018
This is version 178 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again