Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tapasin

Gene

TAPBP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading).2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei428May be involved in interaction with TAP1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • MHC class I protein binding Source: UniProtKB
  • peptide antigen binding Source: UniProtKB
  • peptide antigen-transporting ATPase activity Source: ProtInc
  • TAP1 binding Source: UniProtKB
  • TAP2 binding Source: UniProtKB
  • TAP complex binding Source: UniProtKB
  • unfolded protein binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1236974 ER-Phagosome pathway
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tapasin1 Publication
Short name:
TPN
Short name:
TPSN
Alternative name(s):
NGS-17
TAP-associated protein
TAP-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TAPBPImported
Synonyms:NGS17, TAPA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000231925.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11566 TAPBP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601962 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15533

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini21 – 414LumenalSequence analysisAdd BLAST394
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei415 – 435HelicalSequence analysisAdd BLAST21
Topological domaini436 – 448CytoplasmicSequence analysisAdd BLAST13

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Bare lymphocyte syndrome 1 (BLS1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA HLA class I deficiency. Contrary to bare lymphocyte syndromes type 2 and type 3, which are characterized by early-onset severe combined immunodeficiency, class I antigen deficiencies are not accompanied by particular pathologic manifestations during the first years of life. Systemic infections have not been described. Chronic bacterial infections, often beginning in the first decade of life, are restricted to the respiratory tract.
See also OMIM:604571

Organism-specific databases

DisGeNET

More...
DisGeNETi
6892

MalaCards human disease database

More...
MalaCardsi
TAPBP
MIMi604571 phenotype

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
34592 Immunodeficiency by defective expression of HLA class 1

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36331

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TAPBP

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Combined sourcesAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001499021 – 448TapasinAdd BLAST428

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi27 ↔ 91PROSITE-ProRule annotation1 Publication
Disulfide bondi115Interchain (with C-57 in PDIA3)PROSITE-ProRule annotation1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi253N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi315 ↔ 382PROSITE-ProRule annotation1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15533

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15533

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15533

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15533

PeptideAtlas

More...
PeptideAtlasi
O15533

PRoteomics IDEntifications database

More...
PRIDEi
O15533

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48740
48741 [O15533-2]
48742 [O15533-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O15533-3 [O15533-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1784

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15533

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15533

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Neutrophils, mostly in fully differentiated cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000231925 Expressed in 222 organ(s), highest expression level in islet of Langerhans

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15533 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15533 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007066

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with PDIA3; disulfide-linked. Interacts with TAP1 and is thus a subunit of the TAP complex, also known as the peptide loading complex (PLC). Interaction with TAP1 is TAP2-independent and is required for efficient peptide-TAP interaction. Obligatory mediator for the interaction between newly assembled MHC class I molecules, calreticulin, PDIA3 and TAP. Up to 4 MHC class I/tapasin complexes bind to 1 TAP. Interacts with HLA-G-B2M complex; this interaction is required for loading of high affinity peptides and translocation to the cell surface.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112755, 18 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-2375 Tapasin-ERp57 complex

Protein interaction database and analysis system

More...
IntActi
O15533, 13 interactors

Molecular INTeraction database

More...
MINTi
O15533

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000404833

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1448
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3F8UX-ray2.60B/D1-401[»]
6ENYelectron microscopy5.80C21-448[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15533

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15533

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
O15533

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini292 – 399Ig-like C1-typeAdd BLAST108

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminal region.1 Publication

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II43 Eukaryota
ENOG4111QPK LUCA

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005156

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15533

KEGG Orthology (KO)

More...
KOi
K08058

Database of Orthologous Groups

More...
OrthoDBi
865957at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15533

TreeFam database of animal gene trees

More...
TreeFami
TF334274

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003597 Ig_C1-set
IPR008056 Tapasin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07654 C1-set, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01669 TAPASIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15533-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSLSLLLAV ALGLATAVSA GPAVIECWFV EDASGKGLAK RPGALLLRQG
60 70 80 90 100
PGEPPPRPDL DPELYLSVHD PAGALQAAFR RYPRGAPAPH CEMSRFVPLP
110 120 130 140 150
ASAKWASGLT PAQNCPRALD GAWLMVSISS PVLSLSSLLR PQPEPQQEPV
160 170 180 190 200
LITMATVVLT VLTHTPAPRV RLGQDALLDL SFAYMPPTSE AASSLAPGPP
210 220 230 240 250
PFGLEWRRQH LGKGHLLLAA TPGLNGQMPA AQEGAVAFAA WDDDEPWGPW
260 270 280 290 300
TGNGTFWLPR VQPFQEGTYL ATIHLPYLQG QVTLELAVYK PPKVSLMPAT
310 320 330 340 350
LARAAPGEAP PELLCLVSHF YPSGGLEVEW ELRGGPGGRS QKAEGQRWLS
360 370 380 390 400
ALRHHSDGSV SLSGHLQPPP VTTEQHGARY ACRIHHPSLP ASGRSAEVTL
410 420 430 440
EVAGLSGPSL EDSVGLFLSA FLLLGLFKAL GWAAVYLSTC KDSKKKAE
Length:448
Mass (Da):47,626
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7340549519B288AD
GO
Isoform 2 (identifier: O15533-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-448: LSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE → KSWELCGI

Note: Due to a partial intron retention.
Show »
Length:412
Mass (Da):43,885
Checksum:iE50E3F41AD7E7EA8
GO
Isoform 3 (identifier: O15533-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     446-448: KAE → VQCSTSLYLSLVTLSPHPISKPMEGGCWCGRQNLGLEFTLIWVKTWHYILTVGLFEHAT

Note: No experimental confirmation available.
Show »
Length:504
Mass (Da):53,943
Checksum:iBEF063064284DE16
GO
Isoform 4 (identifier: O15533-4) [UniParc]FASTAAdd to basket
Also known as: tpsnDeltaEx3

The sequence of this isoform differs from the canonical sequence as follows:
     70-156: Missing.

Show »
Length:361
Mass (Da):38,365
Checksum:iE049AA2C6F0B4DED
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSV9A0A0A0MSV9_HUMAN
Tapasin
TAPBP
504Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AB90A2AB90_HUMAN
Tapasin
TAPBP
466Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JH37A0A0G2JH37_HUMAN
Tapasin
TAPBP
466Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JKZ1A0A0G2JKZ1_HUMAN
Tapasin
TAPBP
448Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT98A0A0A0MT98_HUMAN
Tapasin
TAPBP
361Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JA35C9JA35_HUMAN
Tapasin
TAPBP
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6P1N7Q6P1N7_HUMAN
TAPBP protein
TAPBP
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JJI5A0A0G2JJI5_HUMAN
Tapasin
TAPBP
202Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T9B2A0A140T9B2_HUMAN
Tapasin
TAPBP
202Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD32924 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti274H → Y in AAH80574 (PubMed:15489334).Curated1
Sequence conflicti296L → P in ACD68200 (PubMed:20600451).Curated1
Sequence conflicti412D → N in AAD32924 (PubMed:14668790).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The 2 alleles of TAPBP; TAPBP*01 (Tapasin*01) (shown here) and TAPBP*02 (Tapasin*02); are in linkage disequilibria with the HLA-DRB1 locus in a Japanese population.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_010253260R → T in allele TAPBP*02. 3 PublicationsCorresponds to variant dbSNP:rs2071888Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04445570 – 156Missing in isoform 4. 1 PublicationAdd BLAST87
Alternative sequenceiVSP_002577405 – 448LSGPS…KKKAE → KSWELCGI in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_017055446 – 448KAE → VQCSTSLYLSLVTLSPHPIS KPMEGGCWCGRQNLGLEFTL IWVKTWHYILTVGLFEHAT in isoform 3. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y13582 mRNA Translation: CAA73909.1
AF009510 mRNA Translation: AAC20076.1
AB010639 mRNA Translation: BAA28757.1
AB012622 Genomic DNA Translation: BAA28758.1
AB012920 Genomic DNA Translation: BAA28759.1
AF029750 mRNA Translation: AAB82949.1
AF067286 mRNA Translation: AAD32924.2 Sequence problems.
AF314222 mRNA Translation: AAG33061.1
EU693375 mRNA Translation: ACD68200.1
AL662820 Genomic DNA No translation available.
AL662827 Genomic DNA No translation available.
BX248088 Genomic DNA No translation available.
CR759786 Genomic DNA No translation available.
CR759817 Genomic DNA No translation available.
Z97183 Genomic DNA No translation available.
Z97184 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03717.1
BC080574 mRNA Translation: AAH80574.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34426.1 [O15533-1]
CCDS34427.2 [O15533-4]
CCDS34428.2 [O15533-3]

NCBI Reference Sequences

More...
RefSeqi
NP_003181.3, NM_003190.4
NP_757345.2, NM_172208.2
NP_757346.2, NM_172209.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.370937

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374572; ENSP00000363700; ENSG00000112493 [O15533-1]
ENST00000383066; ENSP00000372543; ENSG00000206208
ENST00000383197; ENSP00000372684; ENSG00000206281 [O15533-3]
ENST00000383198; ENSP00000372685; ENSG00000206281 [O15533-1]
ENST00000395114; ENSP00000378546; ENSG00000112493 [O15533-3]
ENST00000417059; ENSP00000402087; ENSG00000236490 [O15533-1]
ENST00000434618; ENSP00000395701; ENSG00000231925
ENST00000456807; ENSP00000407195; ENSG00000236490 [O15533-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6892

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6892

UCSC genome browser

More...
UCSCi
uc003odx.3 human [O15533-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

TAPBPbase

TAPBP mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y13582 mRNA Translation: CAA73909.1
AF009510 mRNA Translation: AAC20076.1
AB010639 mRNA Translation: BAA28757.1
AB012622 Genomic DNA Translation: BAA28758.1
AB012920 Genomic DNA Translation: BAA28759.1
AF029750 mRNA Translation: AAB82949.1
AF067286 mRNA Translation: AAD32924.2 Sequence problems.
AF314222 mRNA Translation: AAG33061.1
EU693375 mRNA Translation: ACD68200.1
AL662820 Genomic DNA No translation available.
AL662827 Genomic DNA No translation available.
BX248088 Genomic DNA No translation available.
CR759786 Genomic DNA No translation available.
CR759817 Genomic DNA No translation available.
Z97183 Genomic DNA No translation available.
Z97184 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03717.1
BC080574 mRNA Translation: AAH80574.1
CCDSiCCDS34426.1 [O15533-1]
CCDS34427.2 [O15533-4]
CCDS34428.2 [O15533-3]
RefSeqiNP_003181.3, NM_003190.4
NP_757345.2, NM_172208.2
NP_757346.2, NM_172209.2
UniGeneiHs.370937

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3F8UX-ray2.60B/D1-401[»]
6ENYelectron microscopy5.80C21-448[»]
ProteinModelPortaliO15533
SMRiO15533
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112755, 18 interactors
ComplexPortaliCPX-2375 Tapasin-ERp57 complex
IntActiO15533, 13 interactors
MINTiO15533
STRINGi9606.ENSP00000404833

PTM databases

GlyConnecti1784
iPTMnetiO15533
PhosphoSitePlusiO15533

Polymorphism and mutation databases

BioMutaiTAPBP

Proteomic databases

EPDiO15533
jPOSTiO15533
MaxQBiO15533
PaxDbiO15533
PeptideAtlasiO15533
PRIDEiO15533
ProteomicsDBi48740
48741 [O15533-2]
48742 [O15533-3]
TopDownProteomicsiO15533-3 [O15533-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6892
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374572; ENSP00000363700; ENSG00000112493 [O15533-1]
ENST00000383066; ENSP00000372543; ENSG00000206208
ENST00000383197; ENSP00000372684; ENSG00000206281 [O15533-3]
ENST00000383198; ENSP00000372685; ENSG00000206281 [O15533-1]
ENST00000395114; ENSP00000378546; ENSG00000112493 [O15533-3]
ENST00000417059; ENSP00000402087; ENSG00000236490 [O15533-1]
ENST00000434618; ENSP00000395701; ENSG00000231925
ENST00000456807; ENSP00000407195; ENSG00000236490 [O15533-3]
GeneIDi6892
KEGGihsa:6892
UCSCiuc003odx.3 human [O15533-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6892
DisGeNETi6892
EuPathDBiHostDB:ENSG00000231925.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TAPBP

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0058157
HIX0166135
HIX0166410
HGNCiHGNC:11566 TAPBP
HPAiHPA007066
MalaCardsiTAPBP
MIMi601962 gene
604571 phenotype
neXtProtiNX_O15533
Orphaneti34592 Immunodeficiency by defective expression of HLA class 1
PharmGKBiPA36331

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410II43 Eukaryota
ENOG4111QPK LUCA
HOVERGENiHBG005156
InParanoidiO15533
KOiK08058
OrthoDBi865957at2759
PhylomeDBiO15533
TreeFamiTF334274

Enzyme and pathway databases

ReactomeiR-HSA-1236974 ER-Phagosome pathway
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TAPBP human
EvolutionaryTraceiO15533

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Tapasin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6892

Protein Ontology

More...
PROi
PR:O15533

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000231925 Expressed in 222 organ(s), highest expression level in islet of Langerhans
ExpressionAtlasiO15533 baseline and differential
GenevisibleiO15533 HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003597 Ig_C1-set
IPR008056 Tapasin
PfamiView protein in Pfam
PF07654 C1-set, 1 hit
PRINTSiPR01669 TAPASIN
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPSN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15533
Secondary accession number(s): A2AB91
, A2ABC0, B0V003, B0V0A6, B2ZUA4, E9PGM2, O15210, O15272, Q5STJ8, Q5STK6, Q5STQ5, Q5STQ6, Q66K65, Q96KK7, Q9HAN8, Q9UEE0, Q9UEE4, Q9UIZ6, Q9Y6K2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again