Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15519 (CFLAR_HUMAN)

Entry version 208 (02 Jun 2021)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Add a publicationFeedback
Protein

CASP8 and FADD-like apoptosis regulator

Gene

CFLAR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O15519

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3371378, Regulation by c-FLIP [O15519-1]
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357905, Regulation of TNFR1 signaling [O15519-1]
R-HSA-69416, Dimerization of procaspase-8 [O15519-2]
R-HSA-75158, TRAIL signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O15519

SIGNOR Signaling Network Open Resource

More...SIGNORi		O15519

Protein family/group databases

MEROPS protease database

More...MEROPSi		C14.971

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CASP8 and FADD-like apoptosis regulator
Alternative name(s):
Caspase homolog
Short name:
CASH
Caspase-eight-related protein
Short name:
Casper
Caspase-like apoptosis regulatory protein
Short name:
CLARP
Cellular FLICE-like inhibitory protein
Short name:
c-FLIP
FADD-like antiapoptotic molecule 1
Short name:
FLAME-1
Inhibitor of FLICE
Short name:
I-FLICE
MACH-related inducer of toxicity
Short name:
MRIT
Usurpin
Cleaved into the following 2 chains:
CASP8 and FADD-like apoptosis regulator subunit p43
CASP8 and FADD-like apoptosis regulator subunit p12
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CFLAR
Synonyms:CASH, CASP8AP1, CLARP, MRIT
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1876, CFLAR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603599, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15519

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000003402.19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi360Y → F: Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing. 1 Publication1
Mutagenesisi376D → N or A: Abolishes proteolytic processing. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		8837

Open Targets

More...OpenTargetsi		ENSG00000003402

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26425

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O15519, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1955713

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CFLAR

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000046781 – 376CASP8 and FADD-like apoptosis regulator subunit p43Add BLAST376
ChainiPRO_0000004679377 – 480CASP8 and FADD-like apoptosis regulator subunit p121 PublicationAdd BLAST104

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically processed by CASP8 generating subunit p43 and p12.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei369 – 370Cleavage; by CASP8By similarity2
Sitei376 – 377Cleavage; by CASP81 Publication2

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		O15519

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O15519

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O15519

MaxQB - The MaxQuant DataBase

More...MaxQBi		O15519

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O15519

PeptideAtlas

More...PeptideAtlasi		O15519

PRoteomics IDEntifications database

More...PRIDEi		O15519

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4369
48707 [O15519-1]
48708 [O15519-10]
48709 [O15519-11]
48710 [O15519-12]
48711 [O15519-13]
48712 [O15519-14]
48713 [O15519-2]
48714 [O15519-3]
48715 [O15519-4]
48716 [O15519-5]
48717 [O15519-6]
48718 [O15519-7]
48719 [O15519-8]
48720 [O15519-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15519

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15519

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Repressed by IL2/interleukin-2 after TCR stimulation, during progression to the S phase of the cell cycle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000003402, Expressed in lower esophagus muscularis layer and 241 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O15519, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15519, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000003402, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

TNFRSF6 stimulation triggers recruitment to the death-inducing signaling complex (DISC) formed by TNFRSF6, FADD and CASP8 (PubMed:9880531). A proteolytic fragment (p43) stays associated with the DISC (PubMed:9880531).

Also interacts with FADD, CASP8, CASP3, TRAF1, TRAF2 and Bcl-X(L) (in vitro) (PubMed:9326610, PubMed:9208847).

Interacts with RIPK1 (By similarity) (PubMed:9326610, PubMed:9208847, PubMed:9880531).

By similarity3 Publications

(Microbial infection) Interacts with HBV protein X.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114364, 51 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		O15519

Database of interacting proteins

More...DIPi		DIP-27629N

Protein interaction database and analysis system

More...IntActi		O15519, 31 interactors

Molecular INTeraction database

More...MINTi		O15519

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000312455

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O15519, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1480
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15519

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O15519

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 73DED 1PROSITE-ProRule annotationAdd BLAST73
Domaini92 – 170DED 2PROSITE-ProRule annotationAdd BLAST79

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 435Not proteolytically processed and involved in apoptosis inhibitionAdd BLAST435
Regioni1 – 305Interaction with CASP8 propeptide2 PublicationsAdd BLAST305
Regioni1 – 227Interaction with FADD2 PublicationsAdd BLAST227
Regioni1 – 195Interaction with CASP82 PublicationsAdd BLAST195
Regioni192 – 480Interaction with TRAF1 and TRAF21 PublicationAdd BLAST289
Regioni192 – 435Interaction with CASP32 PublicationsAdd BLAST244
Regioni217 – 480Interaction with CASP8 subunits p18 and p102 PublicationsAdd BLAST264
Regioni263 – 358CaspaseAdd BLAST96
Regioni370 – 480Interaction with CASP82 PublicationsAdd BLAST111

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The caspase domain lacks the active site residues involved in catalysis.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3573, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00530000064199

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1030405_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15519

Identification of Orthologs from Complete Genome Data

More...OMAi		VYDWNSR

Database of Orthologous Groups

More...OrthoDBi		939331at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15519

TreeFam database of animal gene trees

More...TreeFami		TF352765

Family and domain databases

Conserved Domains Database

More...CDDi		cd00032, CASc, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029030, Caspase-like_dom_sf
IPR011029, DEATH-like_dom_sf
IPR001875, DED_dom
IPR002398, Pept_C14
IPR001309, Pept_C14_p20
IPR015917, Pept_C14A

The PANTHER Classification System

More...PANTHERi		PTHR10454, PTHR10454, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01335, DED, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00115, CASc, 1 hit
SM00031, DED, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47986, SSF47986, 2 hits
SSF52129, SSF52129, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50208, CASPASE_P20, 1 hit
PS50168, DED, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (15+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 15 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 15 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15519-1) [UniParc]FASTAAdd to basket
Also known as: FLIP-L, CLARP1, MRIT alpha-1, CASH alpha, I-FLICE 1, FLAME-1 gamma, Usurpin alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAEVIHQVE EALDTDEKEM LLFLCRDVAI DVVPPNVRDL LDILRERGKL 
        60         70         80         90        100
SVGDLAELLY RVRRFDLLKR ILKMDRKAVE THLLRNPHLV SDYRVLMAEI 
       110        120        130        140        150
GEDLDKSDVS SLIFLMKDYM GRGKISKEKS FLDLVVELEK LNLVAPDQLD 
       160        170        180        190        200
LLEKCLKNIH RIDLKTKIQK YKQSVQGAGT SYRNVLQAAI QKSLKDPSNN 
       210        220        230        240        250
FRLHNGRSKE QRLKEQLGAQ QEPVKKSIQE SEAFLPQSIP EERYKMKSKP 
       260        270        280        290        300
LGICLIIDCI GNETELLRDT FTSLGYEVQK FLHLSMHGIS QILGQFACMP 
       310        320        330        340        350
EHRDYDSFVC VLVSRGGSQS VYGVDQTHSG LPLHHIRRMF MGDSCPYLAG 
       360        370        380        390        400
KPKMFFIQNY VVSEGQLEDS SLLEVDGPAM KNVEFKAQKR GLCTVHREAD 
       410        420        430        440        450
FFWSLCTADM SLLEQSHSSP SLYLQCLSQK LRQERKRPLL DLHIELNGYM 
       460        470        480
YDWNSRVSAK EKYYVWLQHT LRKKLILSYT
Length:480
Mass (Da):55,344
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8C6D7E92AE1EB672
GO
Isoform 2 (identifier: O15519-2) [UniParc]FASTAAdd to basket
Also known as: FLIP-S, CLARP2, MRIT beta-1, CASH beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-221: LHNGRSKEQRLKEQLGAQQ → MITPYAHCPDLKILGNCSM
     222-480: Missing.

Show »
Length:221
Mass (Da):25,379
Checksum:i12774D7AB3E53263
GO
Isoform 3 (identifier: O15519-3) [UniParc]FASTAAdd to basket
Also known as: MRIT alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:366
Mass (Da):41,319
Checksum:iB5DB6C8A18608582
GO
Isoform 4 (identifier: O15519-4) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-245: Missing.

Show »
Length:235
Mass (Da):27,055
Checksum:i1B34FA73556DC390
GO
Isoform 5 (identifier: O15519-5) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 3

The sequence of this isoform differs from the canonical sequence as follows:
     449-480: YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → L

Show »
Length:449
Mass (Da):51,390
Checksum:i8AC8D85BA2F72F7E
GO
Isoform 6 (identifier: O15519-6) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 4

The sequence of this isoform differs from the canonical sequence as follows:
     2-30: SAEVIHQVEEALDTDEKEMLLFLCRDVAI → LERPPVCSKV
     453-480: WNSRVSAKEKYYVWLQHTLRKKLILSYT → SLEHTGGRY

Show »
Length:442
Mass (Da):50,661
Checksum:iB20A318B728B2543
GO
Isoform 7 (identifier: O15519-7) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     203-221: LHNGRSKEQRLKEQLGAQQ → E
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:348
Mass (Da):39,245
Checksum:iE9F524387399F9CA
GO
Isoform 8 (identifier: O15519-8) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 alpha

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.

Show »
Length:445
Mass (Da):51,330
Checksum:i91CD549119606DB2
GO
Isoform 9 (identifier: O15519-9) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.
     267-305: LRDTFTSLGY...FACMPEHRDY → CGVRGPAGGQ...ARAVHSSPRS
     306-480: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:270
Mass (Da):30,399
Checksum:i230E9C0C0ADD1003
GO
Isoform 10 (identifier: O15519-10) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 delta

The sequence of this isoform differs from the canonical sequence as follows:
     266-300: LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP → NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL
     301-480: Missing.

Show »
Length:300
Mass (Da):34,384
Checksum:iF6A777C2BA1469EF
GO
Isoform 11 (identifier: O15519-11) [UniParc]FASTAAdd to basket
Also known as: Usurpin beta

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:462
Mass (Da):52,551
Checksum:iD4E0109CBA47EAA3
GO
Isoform 12 (identifier: O15519-12) [UniParc]FASTAAdd to basket
Also known as: Usurpin gamma

The sequence of this isoform differs from the canonical sequence as follows:
     265-292: ELLRDTFTSLGYEVQKFLHLSMHGISQI → GWSAMAQSQLTAISTSQVQAILLPQPPE
     293-480: Missing.

Show »
Length:292
Mass (Da):33,273
Checksum:i542E30BD5169F336
GO
Isoform 13 (identifier: O15519-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-480: Missing.

Show »
Length:202
Mass (Da):23,289
Checksum:i67D3C756AFD14F94
GO
Isoform 14 (identifier: O15519-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: Missing.

Show »
Length:435
Mass (Da):49,778
Checksum:iB37ED523D7738376
GO
Isoform 15 (identifier: O15519-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:384
Mass (Da):44,112
Checksum:i846E6372DB81F0F6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MR92A0A0A0MR92_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
321Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PAP3E9PAP3_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBH9F8WBH9_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
243Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J408C9J408_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JV51C9JV51_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J4Q0C9J4Q0_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QYM0M0QYM0_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
168Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1A8M0R1A8_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QY57M0QY57_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSU3C9JSU3_HUMAN
CASP8 and FADD-like apoptosis regul...
CFLAR
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti130 – 132SFL → ISW in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti130 – 132SFL → ISW in AAC15826 (PubMed:9380701).Curated3
Sequence conflicti343D → E in AAC15825 (PubMed:9380701).Curated1
Sequence conflicti364E → D in AAB99794 (Ref. 6) Curated1
Sequence conflicti366 – 368QLE → PAG in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti369D → N in CAA74366 (PubMed:9289491).Curated1
Sequence conflicti372L → F in AAB99793 (Ref. 6) Curated1
Sequence conflicti373 – 374LE → WR in AAC15825 (PubMed:9380701).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048619203L → I. Corresponds to variant dbSNP:rs13424615EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0008251 – 245Missing in isoform 4. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_0008241 – 96Missing in isoform 3, isoform 7 and isoform 15. 3 PublicationsAdd BLAST96
Alternative sequenceiVSP_0008262 – 30SAEVI…RDVAI → LERPPVCSKV in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000831203 – 480Missing in isoform 13. 1 PublicationAdd BLAST278
Alternative sequenceiVSP_000830203 – 237Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000828203 – 221LHNGR…LGAQQ → MITPYAHCPDLKILGNCSM in isoform 2. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_000827203 – 221LHNGR…LGAQQ → E in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_000829222 – 480Missing in isoform 2. 4 PublicationsAdd BLAST259
Alternative sequenceiVSP_000832265 – 292ELLRD…GISQI → GWSAMAQSQLTAISTSQVQA ILLPQPPE in isoform 12. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_000834266 – 300LLRDT…FACMP → NAHSWIFTLNSMATCMIGTA EFLPRRNIMFGCSTL in isoform 10. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000836267 – 305LRDTF…EHRDY → CGVRGPAGGQQPLGGGWASD EECGIQGSEARAVHSSPRS in isoform 9. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_000833293 – 480Missing in isoform 12. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_000835301 – 480Missing in isoform 10. 1 PublicationAdd BLAST180
Alternative sequenceiVSP_000837306 – 480Missing in isoform 9. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_000838436 – 480KRPLL…ILSYT → GTIPGSGITESKDMHFSSLG CILLDVL in isoform 11, isoform 7 and isoform 3. 4 PublicationsAdd BLAST45
Alternative sequenceiVSP_000839436 – 480Missing in isoform 14. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_000840449 – 480YMYDW…ILSYT → L in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000841453 – 480WNSRV…ILSYT → SLEHTGGRY in isoform 6. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF010127 mRNA Translation: AAB64110.1
U85059 mRNA Translation: AAB82648.1
U97074 mRNA Translation: AAC51622.1
U97075 mRNA Translation: AAC51623.1
AF009616 mRNA Translation: AAB70909.1
AF009617 mRNA Translation: AAB70910.1
AF009618 mRNA Translation: AAB70911.1
AF009619 mRNA Translation: AAB70912.1
AF041458 mRNA Translation: AAB99790.1
AF041459 mRNA Translation: AAB99791.1
AF041462 mRNA Translation: AAB99794.1
AF041461 mRNA Translation: AAB99793.1
AF041460 mRNA Translation: AAB99792.1
Y14039 mRNA Translation: CAA74366.1
Y14040 mRNA Translation: CAA74367.1
AF005774 mRNA Translation: AAC15825.1
AF005775 mRNA Translation: AAC15826.1
AF015450 mRNA Translation: AAC16439.1
AF015451 mRNA Translation: AAC16440.1
AF015452 mRNA Translation: AAC16441.1
AB038972 Genomic DNA Translation: BAB32551.1
AB038972 Genomic DNA Translation: BAB32552.1
BT006751 mRNA Translation: AAP35397.1
AK289913 mRNA Translation: BAF82602.1
AK296036 mRNA Translation: BAG58802.1
AK315208 mRNA Translation: BAG37645.1
AK315924 mRNA Translation: BAH14295.1
AC007283 Genomic DNA Translation: AAY24290.1
CH471063 Genomic DNA Translation: EAW70237.1
CH471063 Genomic DNA Translation: EAW70244.1
BC001602 mRNA Translation: AAH01602.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2337.1 [O15519-1]
CCDS46487.1 [O15519-2]
CCDS56157.1 [O15519-8]
CCDS56158.1 [O15519-15]
CCDS59436.1 [O15519-3]
CCDS77505.1 [O15519-11]

NCBI Reference Sequences

More...RefSeqi		NP_001120655.1, NM_001127183.2 [O15519-1]
NP_001120656.1, NM_001127184.2 [O15519-2]
NP_001189444.1, NM_001202515.1 [O15519-4]
NP_001189445.1, NM_001202516.1 [O15519-8]
NP_001189446.1, NM_001202517.1 [O15519-15]
NP_001189447.1, NM_001202518.1 [O15519-3]
NP_001189448.1, NM_001202519.1 [O15519-3]
NP_001294971.1, NM_001308042.1 [O15519-11]
NP_003870.4, NM_003879.5 [O15519-1]
XP_016860679.1, XM_017005190.1 [O15519-1]
XP_016860680.1, XM_017005191.1 [O15519-1]
XP_016860681.1, XM_017005192.1
XP_016860682.1, XM_017005193.1 [O15519-11]
XP_016860683.1, XM_017005194.1
XP_016860684.1, XM_017005195.1 [O15519-15]
XP_016860685.1, XM_017005196.1
XP_016860686.1, XM_017005197.1
XP_016860687.1, XM_017005198.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000309955; ENSP00000312455; ENSG00000003402 [O15519-1]
ENST00000341222; ENSP00000339335; ENSG00000003402 [O15519-2]
ENST00000341582; ENSP00000345807; ENSG00000003402 [O15519-8]
ENST00000342795; ENSP00000342809; ENSG00000003402 [O15519-12]
ENST00000423241; ENSP00000399420; ENSG00000003402 [O15519-1]
ENST00000440180; ENSP00000406775; ENSG00000003402 [O15519-2]
ENST00000443227; ENSP00000413270; ENSG00000003402 [O15519-15]
ENST00000457277; ENSP00000411535; ENSG00000003402 [O15519-11]
ENST00000479953; ENSP00000471805; ENSG00000003402 [O15519-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8837

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8837

UCSC genome browser

More...UCSCi		uc002uwz.4, human [O15519-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF010127 mRNA Translation: AAB64110.1
U85059 mRNA Translation: AAB82648.1
U97074 mRNA Translation: AAC51622.1
U97075 mRNA Translation: AAC51623.1
AF009616 mRNA Translation: AAB70909.1
AF009617 mRNA Translation: AAB70910.1
AF009618 mRNA Translation: AAB70911.1
AF009619 mRNA Translation: AAB70912.1
AF041458 mRNA Translation: AAB99790.1
AF041459 mRNA Translation: AAB99791.1
AF041462 mRNA Translation: AAB99794.1
AF041461 mRNA Translation: AAB99793.1
AF041460 mRNA Translation: AAB99792.1
Y14039 mRNA Translation: CAA74366.1
Y14040 mRNA Translation: CAA74367.1
AF005774 mRNA Translation: AAC15825.1
AF005775 mRNA Translation: AAC15826.1
AF015450 mRNA Translation: AAC16439.1
AF015451 mRNA Translation: AAC16440.1
AF015452 mRNA Translation: AAC16441.1
AB038972 Genomic DNA Translation: BAB32551.1
AB038972 Genomic DNA Translation: BAB32552.1
BT006751 mRNA Translation: AAP35397.1
AK289913 mRNA Translation: BAF82602.1
AK296036 mRNA Translation: BAG58802.1
AK315208 mRNA Translation: BAG37645.1
AK315924 mRNA Translation: BAH14295.1
AC007283 Genomic DNA Translation: AAY24290.1
CH471063 Genomic DNA Translation: EAW70237.1
CH471063 Genomic DNA Translation: EAW70244.1
BC001602 mRNA Translation: AAH01602.1
CCDSiCCDS2337.1 [O15519-1]
CCDS46487.1 [O15519-2]
CCDS56157.1 [O15519-8]
CCDS56158.1 [O15519-15]
CCDS59436.1 [O15519-3]
CCDS77505.1 [O15519-11]
RefSeqiNP_001120655.1, NM_001127183.2 [O15519-1]
NP_001120656.1, NM_001127184.2 [O15519-2]
NP_001189444.1, NM_001202515.1 [O15519-4]
NP_001189445.1, NM_001202516.1 [O15519-8]
NP_001189446.1, NM_001202517.1 [O15519-15]
NP_001189447.1, NM_001202518.1 [O15519-3]
NP_001189448.1, NM_001202519.1 [O15519-3]
NP_001294971.1, NM_001308042.1 [O15519-11]
NP_003870.4, NM_003879.5 [O15519-1]
XP_016860679.1, XM_017005190.1 [O15519-1]
XP_016860680.1, XM_017005191.1 [O15519-1]
XP_016860681.1, XM_017005192.1
XP_016860682.1, XM_017005193.1 [O15519-11]
XP_016860683.1, XM_017005194.1
XP_016860684.1, XM_017005195.1 [O15519-15]
XP_016860685.1, XM_017005196.1
XP_016860686.1, XM_017005197.1
XP_016860687.1, XM_017005198.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2N5RNMR-A62-73[»]
3H11X-ray1.90A209-480[»]
3H13X-ray2.20A209-480[»]
SMRiO15519
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114364, 51 interactors
CORUMiO15519
DIPiDIP-27629N
IntActiO15519, 31 interactors
MINTiO15519
STRINGi9606.ENSP00000312455

Chemistry databases

ChEMBLiCHEMBL1955713

Protein family/group databases

MEROPSiC14.971

PTM databases

iPTMnetiO15519
PhosphoSitePlusiO15519

Genetic variation databases

BioMutaiCFLAR

Proteomic databases

EPDiO15519
jPOSTiO15519
MassIVEiO15519
MaxQBiO15519
PaxDbiO15519
PeptideAtlasiO15519
PRIDEiO15519
ProteomicsDBi4369
48707 [O15519-1]
48708 [O15519-10]
48709 [O15519-11]
48710 [O15519-12]
48711 [O15519-13]
48712 [O15519-14]
48713 [O15519-2]
48714 [O15519-3]
48715 [O15519-4]
48716 [O15519-5]
48717 [O15519-6]
48718 [O15519-7]
48719 [O15519-8]
48720 [O15519-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		19934, 943 antibodies

The DNASU plasmid repository

More...DNASUi		8837

Genome annotation databases

EnsembliENST00000309955; ENSP00000312455; ENSG00000003402 [O15519-1]
ENST00000341222; ENSP00000339335; ENSG00000003402 [O15519-2]
ENST00000341582; ENSP00000345807; ENSG00000003402 [O15519-8]
ENST00000342795; ENSP00000342809; ENSG00000003402 [O15519-12]
ENST00000423241; ENSP00000399420; ENSG00000003402 [O15519-1]
ENST00000440180; ENSP00000406775; ENSG00000003402 [O15519-2]
ENST00000443227; ENSP00000413270; ENSG00000003402 [O15519-15]
ENST00000457277; ENSP00000411535; ENSG00000003402 [O15519-11]
ENST00000479953; ENSP00000471805; ENSG00000003402 [O15519-3]
GeneIDi8837
KEGGihsa:8837
UCSCiuc002uwz.4, human [O15519-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8837
DisGeNETi8837

GeneCards: human genes, protein and diseases

More...GeneCardsi		CFLAR
HGNCiHGNC:1876, CFLAR
HPAiENSG00000003402, Low tissue specificity
MIMi603599, gene
neXtProtiNX_O15519
OpenTargetsiENSG00000003402
PharmGKBiPA26425
VEuPathDBiHostDB:ENSG00000003402.19

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3573, Eukaryota
GeneTreeiENSGT00530000064199
HOGENOMiCLU_1030405_0_0_1
InParanoidiO15519
OMAiVYDWNSR
OrthoDBi939331at2759
PhylomeDBiO15519
TreeFamiTF352765

Enzyme and pathway databases

PathwayCommonsiO15519
ReactomeiR-HSA-3371378, Regulation by c-FLIP [O15519-1]
R-HSA-5213460, RIPK1-mediated regulated necrosis
R-HSA-5218900, CASP8 activity is inhibited
R-HSA-5357905, Regulation of TNFR1 signaling [O15519-1]
R-HSA-69416, Dimerization of procaspase-8 [O15519-2]
R-HSA-75158, TRAIL signaling
SignaLinkiO15519
SIGNORiO15519

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8837, 330 hits in 996 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CFLAR, human
EvolutionaryTraceiO15519

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CFLAR

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8837
PharosiO15519, Tbio

Protein Ontology

More...PROi		PR:O15519
RNActiO15519, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000003402, Expressed in lower esophagus muscularis layer and 241 other tissues
ExpressionAtlasiO15519, baseline and differential
GenevisibleiO15519, HS

Family and domain databases

CDDicd00032, CASc, 1 hit
InterProiView protein in InterPro
IPR029030, Caspase-like_dom_sf
IPR011029, DEATH-like_dom_sf
IPR001875, DED_dom
IPR002398, Pept_C14
IPR001309, Pept_C14_p20
IPR015917, Pept_C14A
PANTHERiPTHR10454, PTHR10454, 1 hit
PfamiView protein in Pfam
PF01335, DED, 2 hits
SMARTiView protein in SMART
SM00115, CASc, 1 hit
SM00031, DED, 2 hits
SUPFAMiSSF47986, SSF47986, 2 hits
SSF52129, SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS50208, CASPASE_P20, 1 hit
PS50168, DED, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCFLAR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15519
Secondary accession number(s): B4DJE0
, B7Z9F9, O14673, O14674, O14675, O15137, O15138, O15356, O15510, O43618, O43619, O43620, O60458, O60459, Q53TS6, Q54AF1, Q96TE4, Q9UEW1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: June 2, 2021
This is version 208 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again