Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CASP8 and FADD-like apoptosis regulator

Gene

CFLAR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-3371378 Regulation by c-FLIP
R-HSA-5213460 RIPK1-mediated regulated necrosis
R-HSA-5218900 CASP8 activity is inhibited
R-HSA-69416 Dimerization of procaspase-8
R-HSA-75158 TRAIL signaling
SignaLinkiO15519
SIGNORiO15519

Protein family/group databases

MEROPSiC14.971

Names & Taxonomyi

Protein namesi
Recommended name:
CASP8 and FADD-like apoptosis regulator
Alternative name(s):
Caspase homolog
Short name:
CASH
Caspase-eight-related protein
Short name:
Casper
Caspase-like apoptosis regulatory protein
Short name:
CLARP
Cellular FLICE-like inhibitory protein
Short name:
c-FLIP
FADD-like antiapoptotic molecule 1
Short name:
FLAME-1
Inhibitor of FLICE
Short name:
I-FLICE
MACH-related inducer of toxicity
Short name:
MRIT
Usurpin
Cleaved into the following 2 chains:
Gene namesi
Name:CFLAR
Synonyms:CASH, CASP8AP1, CLARP, MRIT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000003402.19
HGNCiHGNC:1876 CFLAR
MIMi603599 gene
neXtProtiNX_O15519

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi360Y → F: Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing. 1 Publication1
Mutagenesisi376D → N or A: Abolishes proteolytic processing. 1 Publication1

Organism-specific databases

DisGeNETi8837
OpenTargetsiENSG00000003402
PharmGKBiPA26425

Chemistry databases

ChEMBLiCHEMBL1955713

Polymorphism and mutation databases

BioMutaiCFLAR

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000046781 – 376CASP8 and FADD-like apoptosis regulator subunit p43Add BLAST376
ChainiPRO_0000004679377 – 480CASP8 and FADD-like apoptosis regulator subunit p12Sequence analysisAdd BLAST104

Post-translational modificationi

Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12.

Proteomic databases

EPDiO15519
MaxQBiO15519
PaxDbiO15519
PeptideAtlasiO15519
PRIDEiO15519
ProteomicsDBi48707
48708 [O15519-10]
48709 [O15519-11]
48710 [O15519-12]
48711 [O15519-13]
48712 [O15519-14]
48713 [O15519-2]
48714 [O15519-3]
48715 [O15519-4]
48716 [O15519-5]
48717 [O15519-6]
48718 [O15519-7]
48719 [O15519-8]
48720 [O15519-9]

PTM databases

iPTMnetiO15519
PhosphoSitePlusiO15519

Expressioni

Tissue specificityi

Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.

Inductioni

Repressed by IL2/interleukin-2 after TCR stimulation, during progression to the S phase of the cell cycle.1 Publication

Gene expression databases

BgeeiENSG00000003402
ExpressionAtlasiO15519 baseline and differential
GenevisibleiO15519 HS

Organism-specific databases

HPAiCAB022157
CAB025216
HPA019044

Interactioni

Subunit structurei

TNFRSF6 stimulation triggers recruitment to the death-inducing signaling complex (DISC) formed by TNFRSF6, FADD and caspase-8. A proteolytic fragment (p43) stays associated with the DISC. Also interacts with caspase-10, caspase-3, TRAF1, TRAF2 and Bcl-X(L) (in vitro).
(Microbial infection) Interacts with HBV protein X.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • death receptor binding Source: Ensembl
  • protease binding Source: UniProtKB
  • protein heterodimerization activity Source: Ensembl

Protein-protein interaction databases

BioGridi114364, 41 interactors
CORUMiO15519
DIPiDIP-27629N
IntActiO15519, 45 interactors
MINTiO15519
STRINGi9606.ENSP00000312455

Structurei

Secondary structure

1480
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi67 – 71Combined sources5
Beta strandi239 – 241Combined sources3
Beta strandi249 – 260Combined sources12
Helixi266 – 274Combined sources9
Beta strandi276 – 283Combined sources8
Helixi286 – 297Combined sources12
Helixi300 – 304Combined sources5
Beta strandi306 – 317Combined sources12
Helixi333 – 340Combined sources8
Turni342 – 344Combined sources3
Helixi346 – 348Combined sources3
Beta strandi353 – 361Combined sources9
Beta strandi400 – 409Combined sources10
Helixi410 – 412Combined sources3
Helixi422 – 433Combined sources12
Helixi439 – 454Combined sources16
Helixi459 – 461Combined sources3
Beta strandi463 – 469Combined sources7

3D structure databases

ProteinModelPortaliO15519
SMRiO15519
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiO15519

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 73DED 1PROSITE-ProRule annotationAdd BLAST73
Domaini92 – 170DED 2PROSITE-ProRule annotationAdd BLAST79

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 435Not proteolytically processed and involved in apoptosis inhibitionAdd BLAST435
Regioni1 – 305Interaction with caspase-8 propeptideAdd BLAST305
Regioni1 – 227Interaction with FADDAdd BLAST227
Regioni1 – 195Interaction with caspase-8Add BLAST195
Regioni192 – 480Interaction with TRAF1 and TRAF2Add BLAST289
Regioni192 – 435Interaction with caspase-3Add BLAST244
Regioni217 – 480Interaction with caspase-8 subunits p18 and p10Add BLAST264
Regioni263 – 358CaspaseAdd BLAST96
Regioni370 – 480Interaction with caspase-8Add BLAST111

Domaini

The caspase domain lacks the active site residues involved in catalysis.

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00530000064199
HOGENOMiHOG000069972
HOVERGENiHBG050918
InParanoidiO15519
KOiK04724
OMAiYDWNSRV
OrthoDBiEOG091G05YD
PhylomeDBiO15519
TreeFamiTF352765

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR029030 Caspase-like_dom_sf
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PfamiView protein in Pfam
PF01335 DED, 2 hits
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SM00031 DED, 2 hits
SUPFAMiSSF47986 SSF47986, 2 hits
SSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS50208 CASPASE_P20, 1 hit
PS50168 DED, 2 hits

Sequences (15)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 15 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: O15519-1) [UniParc]FASTAAdd to basket
Also known as: FLIP-L, CLARP1, MRIT alpha-1, CASH alpha, I-FLICE 1, FLAME-1 gamma, Usurpin alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAEVIHQVE EALDTDEKEM LLFLCRDVAI DVVPPNVRDL LDILRERGKL
60 70 80 90 100
SVGDLAELLY RVRRFDLLKR ILKMDRKAVE THLLRNPHLV SDYRVLMAEI
110 120 130 140 150
GEDLDKSDVS SLIFLMKDYM GRGKISKEKS FLDLVVELEK LNLVAPDQLD
160 170 180 190 200
LLEKCLKNIH RIDLKTKIQK YKQSVQGAGT SYRNVLQAAI QKSLKDPSNN
210 220 230 240 250
FRLHNGRSKE QRLKEQLGAQ QEPVKKSIQE SEAFLPQSIP EERYKMKSKP
260 270 280 290 300
LGICLIIDCI GNETELLRDT FTSLGYEVQK FLHLSMHGIS QILGQFACMP
310 320 330 340 350
EHRDYDSFVC VLVSRGGSQS VYGVDQTHSG LPLHHIRRMF MGDSCPYLAG
360 370 380 390 400
KPKMFFIQNY VVSEGQLEDS SLLEVDGPAM KNVEFKAQKR GLCTVHREAD
410 420 430 440 450
FFWSLCTADM SLLEQSHSSP SLYLQCLSQK LRQERKRPLL DLHIELNGYM
460 470 480
YDWNSRVSAK EKYYVWLQHT LRKKLILSYT
Length:480
Mass (Da):55,344
Last modified:January 1, 1998 - v1
Checksum:i8C6D7E92AE1EB672
GO
Isoform 2 (identifier: O15519-2) [UniParc]FASTAAdd to basket
Also known as: FLIP-S, CLARP2, MRIT beta-1, CASH beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-221: LHNGRSKEQRLKEQLGAQQ → MITPYAHCPDLKILGNCSM
     222-480: Missing.

Show »
Length:221
Mass (Da):25,379
Checksum:i12774D7AB3E53263
GO
Isoform 3 (identifier: O15519-3) [UniParc]FASTAAdd to basket
Also known as: MRIT alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:366
Mass (Da):41,319
Checksum:iB5DB6C8A18608582
GO
Isoform 4 (identifier: O15519-4) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-245: Missing.

Show »
Length:235
Mass (Da):27,055
Checksum:i1B34FA73556DC390
GO
Isoform 5 (identifier: O15519-5) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 3

The sequence of this isoform differs from the canonical sequence as follows:
     449-480: YMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → L

Show »
Length:449
Mass (Da):51,390
Checksum:i8AC8D85BA2F72F7E
GO
Isoform 6 (identifier: O15519-6) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 4

The sequence of this isoform differs from the canonical sequence as follows:
     2-30: SAEVIHQVEEALDTDEKEMLLFLCRDVAI → LERPPVCSKV
     453-480: WNSRVSAKEKYYVWLQHTLRKKLILSYT → SLEHTGGRY

Show »
Length:442
Mass (Da):50,661
Checksum:iB20A318B728B2543
GO
Isoform 7 (identifier: O15519-7) [UniParc]FASTAAdd to basket
Also known as: I-FLICE 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     203-221: LHNGRSKEQRLKEQLGAQQ → E
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:348
Mass (Da):39,245
Checksum:iE9F524387399F9CA
GO
Isoform 8 (identifier: O15519-8) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 alpha

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.

Show »
Length:445
Mass (Da):51,330
Checksum:i91CD549119606DB2
GO
Isoform 9 (identifier: O15519-9) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 beta

The sequence of this isoform differs from the canonical sequence as follows:
     203-237: Missing.
     267-305: LRDTFTSLGY...FACMPEHRDY → CGVRGPAGGQ...ARAVHSSPRS
     306-480: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:270
Mass (Da):30,399
Checksum:i230E9C0C0ADD1003
GO
Isoform 10 (identifier: O15519-10) [UniParc]FASTAAdd to basket
Also known as: FLAME-1 delta

The sequence of this isoform differs from the canonical sequence as follows:
     266-300: LLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP → NAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL
     301-480: Missing.

Show »
Length:300
Mass (Da):34,384
Checksum:iF6A777C2BA1469EF
GO
Isoform 11 (identifier: O15519-11) [UniParc]FASTAAdd to basket
Also known as: Usurpin beta

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: KRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT → GTIPGSGITESKDMHFSSLGCILLDVL

Show »
Length:462
Mass (Da):52,551
Checksum:iD4E0109CBA47EAA3
GO
Isoform 12 (identifier: O15519-12) [UniParc]FASTAAdd to basket
Also known as: Usurpin gamma

The sequence of this isoform differs from the canonical sequence as follows:
     265-292: ELLRDTFTSLGYEVQKFLHLSMHGISQI → GWSAMAQSQLTAISTSQVQAILLPQPPE
     293-480: Missing.

Show »
Length:292
Mass (Da):33,273
Checksum:i542E30BD5169F336
GO
Isoform 13 (identifier: O15519-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     203-480: Missing.

Show »
Length:202
Mass (Da):23,289
Checksum:i67D3C756AFD14F94
GO
Isoform 14 (identifier: O15519-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-480: Missing.

Show »
Length:435
Mass (Da):49,778
Checksum:iB37ED523D7738376
GO
Isoform 15 (identifier: O15519-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:384
Mass (Da):44,112
Checksum:i846E6372DB81F0F6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130 – 132SFL → ISW in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti130 – 132SFL → ISW in AAC15826 (PubMed:9380701).Curated3
Sequence conflicti343D → E in AAC15825 (PubMed:9380701).Curated1
Sequence conflicti364E → D in AAB99794 (Ref. 6) Curated1
Sequence conflicti366 – 368QLE → PAG in AAC15825 (PubMed:9380701).Curated3
Sequence conflicti369D → N in CAA74366 (PubMed:9289491).Curated1
Sequence conflicti372L → F in AAB99793 (Ref. 6) Curated1
Sequence conflicti373 – 374LE → WR in AAC15825 (PubMed:9380701).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048619203L → I. Corresponds to variant dbSNP:rs13424615Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0008251 – 245Missing in isoform 4. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_0008241 – 96Missing in isoform 3, isoform 7 and isoform 15. 3 PublicationsAdd BLAST96
Alternative sequenceiVSP_0008262 – 30SAEVI…RDVAI → LERPPVCSKV in isoform 6. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_000831203 – 480Missing in isoform 13. 1 PublicationAdd BLAST278
Alternative sequenceiVSP_000830203 – 237Missing in isoform 8 and isoform 9. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000828203 – 221LHNGR…LGAQQ → MITPYAHCPDLKILGNCSM in isoform 2. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_000827203 – 221LHNGR…LGAQQ → E in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_000829222 – 480Missing in isoform 2. 4 PublicationsAdd BLAST259
Alternative sequenceiVSP_000832265 – 292ELLRD…GISQI → GWSAMAQSQLTAISTSQVQA ILLPQPPE in isoform 12. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_000834266 – 300LLRDT…FACMP → NAHSWIFTLNSMATCMIGTA EFLPRRNIMFGCSTL in isoform 10. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_000836267 – 305LRDTF…EHRDY → CGVRGPAGGQQPLGGGWASD EECGIQGSEARAVHSSPRS in isoform 9. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_000833293 – 480Missing in isoform 12. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_000835301 – 480Missing in isoform 10. 1 PublicationAdd BLAST180
Alternative sequenceiVSP_000837306 – 480Missing in isoform 9. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_000838436 – 480KRPLL…ILSYT → GTIPGSGITESKDMHFSSLG CILLDVL in isoform 11, isoform 7 and isoform 3. 4 PublicationsAdd BLAST45
Alternative sequenceiVSP_000839436 – 480Missing in isoform 14. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_000840449 – 480YMYDW…ILSYT → L in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_000841453 – 480WNSRV…ILSYT → SLEHTGGRY in isoform 6. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF010127 mRNA Translation: AAB64110.1
U85059 mRNA Translation: AAB82648.1
U97074 mRNA Translation: AAC51622.1
U97075 mRNA Translation: AAC51623.1
AF009616 mRNA Translation: AAB70909.1
AF009617 mRNA Translation: AAB70910.1
AF009618 mRNA Translation: AAB70911.1
AF009619 mRNA Translation: AAB70912.1
AF041458 mRNA Translation: AAB99790.1
AF041459 mRNA Translation: AAB99791.1
AF041462 mRNA Translation: AAB99794.1
AF041461 mRNA Translation: AAB99793.1
AF041460 mRNA Translation: AAB99792.1
Y14039 mRNA Translation: CAA74366.1
Y14040 mRNA Translation: CAA74367.1
AF005774 mRNA Translation: AAC15825.1
AF005775 mRNA Translation: AAC15826.1
AF015450 mRNA Translation: AAC16439.1
AF015451 mRNA Translation: AAC16440.1
AF015452 mRNA Translation: AAC16441.1
AB038972 Genomic DNA Translation: BAB32551.1
AB038972 Genomic DNA Translation: BAB32552.1
BT006751 mRNA Translation: AAP35397.1
AK289913 mRNA Translation: BAF82602.1
AK296036 mRNA Translation: BAG58802.1
AK315208 mRNA Translation: BAG37645.1
AK315924 mRNA Translation: BAH14295.1
AC007283 Genomic DNA Translation: AAY24290.1
CH471063 Genomic DNA Translation: EAW70237.1
CH471063 Genomic DNA Translation: EAW70244.1
BC001602 mRNA Translation: AAH01602.1
CCDSiCCDS2337.1 [O15519-1]
CCDS46487.1 [O15519-2]
CCDS56157.1 [O15519-8]
CCDS56158.1 [O15519-15]
CCDS59436.1 [O15519-3]
CCDS77505.1 [O15519-11]
RefSeqiNP_001120655.1, NM_001127183.2 [O15519-1]
NP_001120656.1, NM_001127184.2 [O15519-2]
NP_001189444.1, NM_001202515.1 [O15519-4]
NP_001189445.1, NM_001202516.1 [O15519-8]
NP_001189446.1, NM_001202517.1 [O15519-15]
NP_001189447.1, NM_001202518.1 [O15519-3]
NP_001189448.1, NM_001202519.1 [O15519-3]
NP_001294971.1, NM_001308042.1 [O15519-11]
NP_003870.4, NM_003879.5 [O15519-1]
XP_016860679.1, XM_017005190.1 [O15519-1]
XP_016860680.1, XM_017005191.1 [O15519-1]
XP_016860681.1, XM_017005192.1
XP_016860682.1, XM_017005193.1 [O15519-11]
XP_016860683.1, XM_017005194.1
XP_016860684.1, XM_017005195.1 [O15519-15]
XP_016860685.1, XM_017005196.1 [O15519-4]
XP_016860686.1, XM_017005197.1
XP_016860687.1, XM_017005198.1
UniGeneiHs.390736
Hs.731912

Genome annotation databases

EnsembliENST00000309955; ENSP00000312455; ENSG00000003402 [O15519-1]
ENST00000341222; ENSP00000339335; ENSG00000003402 [O15519-2]
ENST00000341582; ENSP00000345807; ENSG00000003402 [O15519-8]
ENST00000342795; ENSP00000342809; ENSG00000003402 [O15519-12]
ENST00000423241; ENSP00000399420; ENSG00000003402 [O15519-1]
ENST00000440180; ENSP00000406775; ENSG00000003402 [O15519-2]
ENST00000443227; ENSP00000413270; ENSG00000003402 [O15519-15]
ENST00000457277; ENSP00000411535; ENSG00000003402 [O15519-11]
ENST00000479953; ENSP00000471805; ENSG00000003402 [O15519-3]
GeneIDi8837
KEGGihsa:8837
UCSCiuc002uwz.4 human [O15519-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCFLAR_HUMAN
AccessioniPrimary (citable) accession number: O15519
Secondary accession number(s): B4DJE0
, B7Z9F9, O14673, O14674, O14675, O15137, O15138, O15356, O15510, O43618, O43619, O43620, O60458, O60459, Q53TS6, Q54AF1, Q96TE4, Q9UEW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: July 18, 2018
This is version 189 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health