Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Canalicular multispecific organic anion transporter 2

Gene

ABCC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi661 – 668ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi1323 – 1330ATP 2PROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-159418 Recycling of bile acids and salts
R-HSA-382556 ABC-family proteins mediated transport

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15438

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.1.208.9 the atp-binding cassette (abc) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Canalicular multispecific organic anion transporter 2
Alternative name(s):
ATP-binding cassette sub-family C member 3
Multi-specific organic anion transporter D
Short name:
MOAT-D
Multidrug resistance-associated protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABCC3
Synonyms:CMOAT2, MLP2, MRP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000108846.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:54 ABCC3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604323 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15438

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 32ExtracellularBy similarityAdd BLAST32
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei33 – 53Helical; Name=1PROSITE-ProRule annotationAdd BLAST21
Topological domaini54 – 73CytoplasmicBy similarityAdd BLAST20
Transmembranei74 – 94Helical; Name=2PROSITE-ProRule annotationAdd BLAST21
Topological domaini95 – 99ExtracellularBy similarity5
Transmembranei100 – 120Helical; Name=3PROSITE-ProRule annotationAdd BLAST21
Topological domaini121 – 132CytoplasmicBy similarityAdd BLAST12
Transmembranei133 – 153Helical; Name=4PROSITE-ProRule annotationAdd BLAST21
Topological domaini154 – 171ExtracellularBy similarityAdd BLAST18
Transmembranei172 – 192Helical; Name=5PROSITE-ProRule annotationAdd BLAST21
Topological domaini193 – 302CytoplasmicBy similarityAdd BLAST110
Transmembranei303 – 323Helical; Name=6PROSITE-ProRule annotationAdd BLAST21
Topological domaini324 – 349ExtracellularBy similarityAdd BLAST26
Transmembranei350 – 370Helical; Name=7PROSITE-ProRule annotationAdd BLAST21
Topological domaini371 – 426CytoplasmicBy similarityAdd BLAST56
Transmembranei427 – 447Helical; Name=8PROSITE-ProRule annotationAdd BLAST21
Topological domaini448 – 450ExtracellularBy similarity3
Transmembranei451 – 471Helical; Name=9PROSITE-ProRule annotationAdd BLAST21
Topological domaini472 – 533CytoplasmicBy similarityAdd BLAST62
Transmembranei534 – 554Helical; Name=10PROSITE-ProRule annotationAdd BLAST21
Topological domaini555 – 576ExtracellularBy similarityAdd BLAST22
Transmembranei577 – 597Helical; Name=11PROSITE-ProRule annotationAdd BLAST21
Topological domaini598 – 963CytoplasmicBy similarityAdd BLAST366
Transmembranei964 – 984Helical; Name=12PROSITE-ProRule annotationAdd BLAST21
Topological domaini985 – 1021ExtracellularBy similarityAdd BLAST37
Transmembranei1022 – 1042Helical; Name=13PROSITE-ProRule annotationAdd BLAST21
Topological domaini1043 – 1085CytoplasmicBy similarityAdd BLAST43
Transmembranei1086 – 1106Helical; Name=14PROSITE-ProRule annotationAdd BLAST21
Topological domaini1107ExtracellularBy similarity1
Transmembranei1108 – 1128Helical; Name=15PROSITE-ProRule annotationAdd BLAST21
Topological domaini1129 – 1199CytoplasmicBy similarityAdd BLAST71
Transmembranei1200 – 1220Helical; Name=16PROSITE-ProRule annotationAdd BLAST21
Topological domaini1221 – 1222ExtracellularBy similarity2
Transmembranei1223 – 1243Helical; Name=17PROSITE-ProRule annotationAdd BLAST21
Topological domaini1244 – 1527CytoplasmicBy similarityAdd BLAST284

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8714

Open Targets

More...
OpenTargetsi
ENSG00000108846

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA376

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5918

Drug and drug target database

More...
DrugBanki
DB02659 Cholic Acid
DB00515 Cisplatin
DB00257 Clotrimazole
DB00286 Conjugated Equine Estrogens
DB00091 Cyclosporine
DB00997 Doxorubicin
DB00773 Etoposide
DB00973 Ezetimibe
DB00544 Fluorouracil
DB00158 Folic Acid
DB08884 Gadoxetic acid
DB00143 Glutathione
DB01016 Glyburide
DB00328 Indomethacin
DB00709 Lamivudine
DB00563 Methotrexate
DB01011 Metyrapone
DB01115 Nifedipine
DB00338 Omeprazole
DB01174 Phenobarbital
DB01032 Probenecid
DB01045 Rifampicin
DB01138 Sulfinpyrazone
DB04348 Taurocholic Acid
DB00661 Verapamil
DB00541 Vincristine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ABCC3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000933601 – 1527Canalicular multispecific organic anion transporter 2Add BLAST1527

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi18N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei908PhosphoserineCombined sources1
Modified residuei911PhosphoserineCombined sources1
Glycosylationi1006N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1007N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
O15438

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15438

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15438

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15438

PeptideAtlas

More...
PeptideAtlasi
O15438

PRoteomics IDEntifications database

More...
PRIDEi
O15438

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48659
48660 [O15438-2]
48661 [O15438-3]
48662 [O15438-4]
48663 [O15438-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15438

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15438

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108846 Expressed in 164 organ(s), highest expression level in left adrenal gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_ABCC3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15438 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15438 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB037136
HPA048483

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114255, 9 interactors

Protein interaction database and analysis system

More...
IntActi
O15438, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000285238

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O15438

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15438

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15438

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini311 – 594ABC transmembrane type-1 1PROSITE-ProRule annotationAdd BLAST284
Domaini629 – 851ABC transporter 1PROSITE-ProRule annotationAdd BLAST223
Domaini971 – 1252ABC transmembrane type-1 2PROSITE-ProRule annotationAdd BLAST282
Domaini1291 – 1523ABC transporter 2PROSITE-ProRule annotationAdd BLAST233

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0054 Eukaryota
COG1132 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161624

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG103029

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15438

KEGG Orthology (KO)

More...
KOi
K05667

Identification of Orthologs from Complete Genome Data

More...
OMAi
AFQVEQM

Database of Orthologous Groups

More...
OrthoDBi
138195at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15438

TreeFam database of animal gene trees

More...
TreeFami
TF105199

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1560.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR005292 Multidrug-R_assoc
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00957 MRP_assoc_pro, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15438-1) [UniParc]FASTAAdd to basket
Also known as: MRP3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDALCGSGEL GSKFWDSNLS VHTENPDLTP CFQNSLLAWV PCIYLWVALP
60 70 80 90 100
CYLLYLRHHC RGYIILSHLS KLKMVLGVLL WCVSWADLFY SFHGLVHGRA
110 120 130 140 150
PAPVFFVTPL VVGVTMLLAT LLIQYERLQG VQSSGVLIIF WFLCVVCAIV
160 170 180 190 200
PFRSKILLAK AEGEISDPFR FTTFYIHFAL VLSALILACF REKPPFFSAK
210 220 230 240 250
NVDPNPYPET SAGFLSRLFF WWFTKMAIYG YRHPLEEKDL WSLKEEDRSQ
260 270 280 290 300
MVVQQLLEAW RKQEKQTARH KASAAPGKNA SGEDEVLLGA RPRPRKPSFL
310 320 330 340 350
KALLATFGSS FLISACFKLI QDLLSFINPQ LLSILIRFIS NPMAPSWWGF
360 370 380 390 400
LVAGLMFLCS MMQSLILQHY YHYIFVTGVK FRTGIMGVIY RKALVITNSV
410 420 430 440 450
KRASTVGEIV NLMSVDAQRF MDLAPFLNLL WSAPLQIILA IYFLWQNLGP
460 470 480 490 500
SVLAGVAFMV LLIPLNGAVA VKMRAFQVKQ MKLKDSRIKL MSEILNGIKV
510 520 530 540 550
LKLYAWEPSF LKQVEGIRQG ELQLLRTAAY LHTTTTFTWM CSPFLVTLIT
560 570 580 590 600
LWVYVYVDPN NVLDAEKAFV SVSLFNILRL PLNMLPQLIS NLTQASVSLK
610 620 630 640 650
RIQQFLSQEE LDPQSVERKT ISPGYAITIH SGTFTWAQDL PPTLHSLDIQ
660 670 680 690 700
VPKGALVAVV GPVGCGKSSL VSALLGEMEK LEGKVHMKGS VAYVPQQAWI
710 720 730 740 750
QNCTLQENVL FGKALNPKRY QQTLEACALL ADLEMLPGGD QTEIGEKGIN
760 770 780 790 800
LSGGQRQRVS LARAVYSDAD IFLLDDPLSA VDSHVAKHIF DHVIGPEGVL
810 820 830 840 850
AGKTRVLVTH GISFLPQTDF IIVLADGQVS EMGPYPALLQ RNGSFANFLC
860 870 880 890 900
NYAPDEDQGH LEDSWTALEG AEDKEALLIE DTLSNHTDLT DNDPVTYVVQ
910 920 930 940 950
KQFMRQLSAL SSDGEGQGRP VPRRHLGPSE KVQVTEAKAD GALTQEEKAA
960 970 980 990 1000
IGTVELSVFW DYAKAVGLCT TLAICLLYVG QSAAAIGANV WLSAWTNDAM
1010 1020 1030 1040 1050
ADSRQNNTSL RLGVYAALGI LQGFLVMLAA MAMAAGGIQA ARVLHQALLH
1060 1070 1080 1090 1100
NKIRSPQSFF DTTPSGRILN CFSKDIYVVD EVLAPVILML LNSFFNAIST
1110 1120 1130 1140 1150
LVVIMASTPL FTVVILPLAV LYTLVQRFYA ATSRQLKRLE SVSRSPIYSH
1160 1170 1180 1190 1200
FSETVTGASV IRAYNRSRDF EIISDTKVDA NQRSCYPYII SNRWLSIGVE
1210 1220 1230 1240 1250
FVGNCVVLFA ALFAVIGRSS LNPGLVGLSV SYSLQVTFAL NWMIRMMSDL
1260 1270 1280 1290 1300
ESNIVAVERV KEYSKTETEA PWVVEGSRPP EGWPPRGEVE FRNYSVRYRP
1310 1320 1330 1340 1350
GLDLVLRDLS LHVHGGEKVG IVGRTGAGKS SMTLCLFRIL EAAKGEIRID
1360 1370 1380 1390 1400
GLNVADIGLH DLRSQLTIIP QDPILFSGTL RMNLDPFGSY SEEDIWWALE
1410 1420 1430 1440 1450
LSHLHTFVSS QPAGLDFQCS EGGENLSVGQ RQLVCLARAL LRKSRILVLD
1460 1470 1480 1490 1500
EATAAIDLET DNLIQATIRT QFDTCTVLTI AHRLNTIMDY TRVLVLDKGV
1510 1520
VAEFDSPANL IAARGIFYGM ARDAGLA
Length:1,527
Mass (Da):169,343
Last modified:May 30, 2000 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0D1F879B6F18370C
GO
Isoform 2 (identifier: O15438-2) [UniParc]FASTAAdd to basket
Also known as: MRP3A

The sequence of this isoform differs from the canonical sequence as follows:
     1194-1527: WLSIGVEFVG...YGMARDAGLA → SEAASLAPCS...ALPLPHFLLI

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,238
Mass (Da):137,297
Checksum:i8E449E28F32BA882
GO
Isoform 3 (identifier: O15438-3) [UniParc]FASTAAdd to basket
Also known as: MRP3B

The sequence of this isoform differs from the canonical sequence as follows:
     226-510: MAIYGYRHPL...LKLYAWEPSF → LLNPDPLRGC...IEGLAHQADE
     511-1527: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:510
Mass (Da):55,305
Checksum:iB00B65CBB262DEAA
GO
Isoform 4 (identifier: O15438-4) [UniParc]FASTAAdd to basket
Also known as: MRP3S1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPACTVKESPNCKRNFCKADHIVNTSGGSNLERVGKQKTIQKGQFSQRSVCT

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:1,578
Mass (Da):174,907
Checksum:i79A1F68027EBE525
GO
Isoform 5 (identifier: O15438-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     547-572: TLITLWVYVYVDPNNVLDAEKAFVSV → RLGTGLGPCLQGSGCPGMARAHWTLP
     573-1527: Missing.

Note: No experimental confirmation available.
Show »
Length:572
Mass (Da):64,632
Checksum:iD50802109C86F4DE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y8Q6H0Y8Q6_HUMAN
Canalicular multispecific organic a...
ABCC3
300Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAB7D6RAB7_HUMAN
Canalicular multispecific organic a...
ABCC3
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9T4H0Y9T4_HUMAN
Canalicular multispecific organic a...
ABCC3
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJE5D6RJE5_HUMAN
Canalicular multispecific organic a...
ABCC3
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8T5H0Y8T5_HUMAN
Canalicular multispecific organic a...
ABCC3
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB71756 differs from that shown. Reason: Frameshift at positions 1334 and 1338.Curated
The sequence AAD01430 differs from that shown. Reason: Frameshift at positions 355, 359 and 361.Curated
The sequence AAD38185 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13K → N in AAH46126 (PubMed:15489334).Curated1
Sequence conflicti42C → R in CAA76658 (PubMed:10094960).Curated1
Sequence conflicti184A → T in AAD02846 (PubMed:9889399).Curated1
Sequence conflicti344A → G in AAC34668 (PubMed:9813153).Curated1
Sequence conflicti569F → Y in BAA28146 (PubMed:9738950).Curated1
Sequence conflicti1128F → C in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1212L → I in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1249D → E in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1359L → F in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1362L → V in AAC34668 (PubMed:9813153).Curated1
Sequence conflicti1362L → V in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1364S → C in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1366L → M in AAB71756 (PubMed:9270026).Curated1
Sequence conflicti1371Q → R in AAB71756 (PubMed:9270026).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02911911G → D. Corresponds to variant dbSNP:rs11568609Ensembl.1
Natural variantiVAR_020235346S → F. Corresponds to variant dbSNP:rs11568605Ensembl.1
Natural variantiVAR_0291201286R → G. Corresponds to variant dbSNP:rs11568593Ensembl.1
Natural variantiVAR_0202371297R → H. Corresponds to variant dbSNP:rs11568591Ensembl.1
Natural variantiVAR_0202391365Q → R. Corresponds to variant dbSNP:rs11568590Ensembl.1
Natural variantiVAR_0202401381R → S. Corresponds to variant dbSNP:rs45461799Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438641M → MPACTVKESPNCKRNFCKAD HIVNTSGGSNLERVGKQKTI QKGQFSQRSVCT in isoform 4. 1 Publication1
Alternative sequenceiVSP_000040226 – 510MAIYG…WEPSF → LLNPDPLRGCLPGFTSPQDG HLWLPASPGGEGPLVPKGRG QIPDGGAAAAGGMEEAGKAD GTTQGFSSTWEKCLRRGRGA AGCPAQAPEALLPEGPAGHL RLQLPHQCLLQAYPGPALLH QSTAAQHPDQVYLQPHGPLL VGLPGGWADVPVLHDAVADL TTLLPLHLCDWGEVSYWDHG CHLQEGSGYHQLSQTCVHCG GNCQPHVSGCPALHGPCPLP QSAVVSTPADHPGDLLPLAE PRSLCPGWSRFHGLADSTQR SCGREDARLPGKANEIEGLA HQADE in isoform 3. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_000041511 – 1527Missing in isoform 3. 1 PublicationAdd BLAST1017
Alternative sequenceiVSP_039041547 – 572TLITL…AFVSV → RLGTGLGPCLQGSGCPGMAR AHWTLP in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_039042573 – 1527Missing in isoform 5. 1 PublicationAdd BLAST955
Alternative sequenceiVSP_0000421194 – 1527WLSIG…DAGLA → SEAASLAPCSSRNSQQALWC SGSLSLLSPKQKTGPALPLP HFLLI in isoform 2. 1 PublicationAdd BLAST334

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF083552 mRNA Translation: AAC34668.1
AB010887 mRNA Translation: BAA28146.1
AF104943 mRNA Translation: AAD04170.1
AF085690 mRNA Translation: AAD02845.1
AF085691 mRNA Translation: AAD02846.1
AF085692 mRNA Translation: AAD02847.1
Y17151 mRNA Translation: CAA76658.2
AF009670 mRNA Translation: AAD01430.1 Frameshift.
AF154001 mRNA Translation: AAD38185.1 Sequence problems.
AC004590 Genomic DNA No translation available.
AC005921 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94592.1
CH471109 Genomic DNA Translation: EAW94590.1
CH471109 Genomic DNA Translation: EAW94593.1
BC046126 mRNA Translation: AAH46126.1
BC137347 mRNA Translation: AAI37348.1
BC137348 mRNA Translation: AAI37349.1
U83659 mRNA Translation: AAB71756.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32681.1 [O15438-1]
CCDS45739.1 [O15438-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0336

NCBI Reference Sequences

More...
RefSeqi
NP_001137542.1, NM_001144070.1 [O15438-5]
NP_003777.2, NM_003786.3 [O15438-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.463421

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000285238; ENSP00000285238; ENSG00000108846 [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846 [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846 [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846 [O15438-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8714

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8714

UCSC genome browser

More...
UCSCi
uc002isk.5 human [O15438-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083552 mRNA Translation: AAC34668.1
AB010887 mRNA Translation: BAA28146.1
AF104943 mRNA Translation: AAD04170.1
AF085690 mRNA Translation: AAD02845.1
AF085691 mRNA Translation: AAD02846.1
AF085692 mRNA Translation: AAD02847.1
Y17151 mRNA Translation: CAA76658.2
AF009670 mRNA Translation: AAD01430.1 Frameshift.
AF154001 mRNA Translation: AAD38185.1 Sequence problems.
AC004590 Genomic DNA No translation available.
AC005921 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94592.1
CH471109 Genomic DNA Translation: EAW94590.1
CH471109 Genomic DNA Translation: EAW94593.1
BC046126 mRNA Translation: AAH46126.1
BC137347 mRNA Translation: AAI37348.1
BC137348 mRNA Translation: AAI37349.1
U83659 mRNA Translation: AAB71756.1 Frameshift.
CCDSiCCDS32681.1 [O15438-1]
CCDS45739.1 [O15438-5]
PIRiJE0336
RefSeqiNP_001137542.1, NM_001144070.1 [O15438-5]
NP_003777.2, NM_003786.3 [O15438-1]
UniGeneiHs.463421

3D structure databases

ProteinModelPortaliO15438
SMRiO15438
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114255, 9 interactors
IntActiO15438, 5 interactors
STRINGi9606.ENSP00000285238

Chemistry databases

BindingDBiO15438
ChEMBLiCHEMBL5918
DrugBankiDB02659 Cholic Acid
DB00515 Cisplatin
DB00257 Clotrimazole
DB00286 Conjugated Equine Estrogens
DB00091 Cyclosporine
DB00997 Doxorubicin
DB00773 Etoposide
DB00973 Ezetimibe
DB00544 Fluorouracil
DB00158 Folic Acid
DB08884 Gadoxetic acid
DB00143 Glutathione
DB01016 Glyburide
DB00328 Indomethacin
DB00709 Lamivudine
DB00563 Methotrexate
DB01011 Metyrapone
DB01115 Nifedipine
DB00338 Omeprazole
DB01174 Phenobarbital
DB01032 Probenecid
DB01045 Rifampicin
DB01138 Sulfinpyrazone
DB04348 Taurocholic Acid
DB00661 Verapamil
DB00541 Vincristine

Protein family/group databases

TCDBi3.A.1.208.9 the atp-binding cassette (abc) superfamily

PTM databases

iPTMnetiO15438
PhosphoSitePlusiO15438

Polymorphism and mutation databases

BioMutaiABCC3

Proteomic databases

EPDiO15438
jPOSTiO15438
MaxQBiO15438
PaxDbiO15438
PeptideAtlasiO15438
PRIDEiO15438
ProteomicsDBi48659
48660 [O15438-2]
48661 [O15438-3]
48662 [O15438-4]
48663 [O15438-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000285238; ENSP00000285238; ENSG00000108846 [O15438-1]
ENST00000427699; ENSP00000395160; ENSG00000108846 [O15438-5]
ENST00000502426; ENSP00000427073; ENSG00000108846 [O15438-3]
ENST00000505699; ENSP00000427521; ENSG00000108846 [O15438-2]
GeneIDi8714
KEGGihsa:8714
UCSCiuc002isk.5 human [O15438-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8714
DisGeNETi8714
EuPathDBiHostDB:ENSG00000108846.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABCC3
HGNCiHGNC:54 ABCC3
HPAiCAB037136
HPA048483
MIMi604323 gene
neXtProtiNX_O15438
OpenTargetsiENSG00000108846
PharmGKBiPA376

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0054 Eukaryota
COG1132 LUCA
GeneTreeiENSGT00940000161624
HOVERGENiHBG103029
InParanoidiO15438
KOiK05667
OMAiAFQVEQM
OrthoDBi138195at2759
PhylomeDBiO15438
TreeFamiTF105199

Enzyme and pathway databases

ReactomeiR-HSA-159418 Recycling of bile acids and salts
R-HSA-382556 ABC-family proteins mediated transport
SIGNORiO15438

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABCC3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ABCC3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8714

Protein Ontology

More...
PROi
PR:O15438

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108846 Expressed in 164 organ(s), highest expression level in left adrenal gland
CleanExiHS_ABCC3
ExpressionAtlasiO15438 baseline and differential
GenevisibleiO15438 HS

Family and domain databases

Gene3Di1.20.1560.10, 2 hits
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR011527 ABC1_TM_dom
IPR036640 ABC1_TM_sf
IPR003439 ABC_transporter-like
IPR017871 ABC_transporter_CS
IPR005292 Multidrug-R_assoc
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00664 ABC_membrane, 2 hits
PF00005 ABC_tran, 2 hits
SMARTiView protein in SMART
SM00382 AAA, 2 hits
SUPFAMiSSF52540 SSF52540, 2 hits
SSF90123 SSF90123, 2 hits
TIGRFAMsiTIGR00957 MRP_assoc_pro, 1 hit
PROSITEiView protein in PROSITE
PS50929 ABC_TM1F, 2 hits
PS00211 ABC_TRANSPORTER_1, 2 hits
PS50893 ABC_TRANSPORTER_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMRP3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15438
Secondary accession number(s): B2RPA9
, D3DTX9, O60265, O60922, O75621, O95078, O95289, O95290, Q86X85, Q9UN52
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: May 30, 2000
Last modified: January 16, 2019
This is version 179 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again