Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15394 (NCAM2_HUMAN)

Entry version 186 (10 Feb 2021)
Sequence version 2 (22 Jul 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Neural cell adhesion molecule 2

Gene

NCAM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

  • axonal fasciculation Source: Ensembl
  • neuron cell-cell adhesion Source: ProtInc
  • sensory perception of smell Source: Ensembl
Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O15394

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neural cell adhesion molecule 2
Short name:
N-CAM-2
Short name:
NCAM-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NCAM2
Synonyms:NCAM21
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7657, NCAM2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602040, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15394

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000154654.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 697ExtracellularSequence analysisAdd BLAST678
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei698 – 718HelicalSequence analysisAdd BLAST21
Topological domaini719 – 837CytoplasmicSequence analysisAdd BLAST119

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		4685

Open Targets

More...OpenTargetsi		ENSG00000154654

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31460

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O15394, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NCAM2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001501820 – 837Neural cell adhesion molecule 2Add BLAST818

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi42 ↔ 93Curated
Disulfide bondi136 ↔ 186Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi232 ↔ 281Curated
Glycosylationi309N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi322 ↔ 380Curated
Glycosylationi406N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi419N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi422 ↔ 475Curated
Glycosylationi445N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi474N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi562N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei765PhosphoserineBy similarity1
Modified residuei780PhosphothreonineBy similarity1
Modified residuei786PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O15394

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O15394

MaxQB - The MaxQuant DataBase

More...MaxQBi		O15394

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O15394

PeptideAtlas

More...PeptideAtlasi		O15394

PRoteomics IDEntifications database

More...PRIDEi		O15394

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48635 [O15394-1]
6923

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1546, 7 N-Linked glycans (3 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		O15394, 12 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15394

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15394

SwissPalm database of S-palmitoylation events

More...SwissPalmi		O15394

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed most strongly in adult and fetal brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000154654, Expressed in corpus callosum and 122 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O15394, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15394, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000154654, Tissue enhanced (adrenal gland, brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

O15394
With#Exp.IntAct
itself3EBI-2679983,EBI-2679983

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		110765, 5 interactors

Database of interacting proteins

More...DIPi		DIP-56211N

Protein interaction database and analysis system

More...IntActi		O15394, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000383392

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O15394, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1837
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15394

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O15394

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 108Ig-like C2-type 1Add BLAST88
Domaini113 – 202Ig-like C2-type 2Add BLAST90
Domaini208 – 297Ig-like C2-type 3Add BLAST90
Domaini302 – 396Ig-like C2-type 4Add BLAST95
Domaini401 – 491Ig-like C2-type 5Add BLAST91
Domaini498 – 591Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST94
Domaini593 – 688Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST96

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3510, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157860

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15394

Identification of Orthologs from Complete Genome Data

More...OMAi		HGGVPIN

Database of Orthologous Groups

More...OrthoDBi		129648at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15394

TreeFam database of animal gene trees

More...TreeFami		TF326195

Family and domain databases

Conserved Domains Database

More...CDDi		cd00063, FN3, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 7 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR009138, Neural_cell_adh

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00041, fn3, 2 hits
PF07679, I-set, 4 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01838, NCAMFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00060, FN3, 2 hits
SM00409, IG, 5 hits
SM00408, IGc2, 5 hits
SM00406, IGv, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 5 hits
SSF49265, SSF49265, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50853, FN3, 2 hits
PS50835, IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O15394-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLLLSFYLL GLLVSSGQAL LQVTISLSKV ELSVGESKFF TCTAIGEPES 
        60         70         80         90        100
IDWYNPQGEK IISTQRVVVQ KEGVRSRLTI YNANIEDAGI YRCQATDAKG 
       110        120        130        140        150
QTQEATVVLE IYQKLTFREV VSPQEFKQGE DAEVVCRVSS SPAPAVSWLY 
       160        170        180        190        200
HNEEVTTISD NRFAMLANNN LQILNINKSD EGIYRCEGRV EARGEIDFRD 
       210        220        230        240        250
IIVIVNVPPA ISMPQKSFNA TAERGEEMTF SCRASGSPEP AISWFRNGKL 
       260        270        280        290        300
IEENEKYILK GSNTELTVRN IINSDGGPYV CRATNKAGED EKQAFLQVFV 
       310        320        330        340        350
QPHIIQLKNE TTYENGQVTL VCDAEGEPIP EITWKRAVDG FTFTEGDKSL 
       360        370        380        390        400
DGRIEVKGQH GSSSLHIKDV KLSDSGRYDC EAASRIGGHQ KSMYLDIEYA 
       410        420        430        440        450
PKFISNQTIY YSWEGNPINI SCDVKSNPPA SIHWRRDKLV LPAKNTTNLK 
       460        470        480        490        500
TYSTGRKMIL EIAPTSDNDF GRYNCTATNH IGTRFQEYIL ALADVPSSPY 
       510        520        530        540        550
GVKIIELSQT TAKVSFNKPD SHGGVPIHHY QVDVKEVASE IWKIVRSHGV 
       560        570        580        590        600
QTMVVLNNLE PNTTYEIRVA AVNGKGQGDY SKIEIFQTLP VREPSPPSIH 
       610        620        630        640        650
GQPSSGKSFK LSITKQDDGG APILEYIVKY RSKDKEDQWL EKKVQGNKDH 
       660        670        680        690        700
IILEHLQWTM GYEVQITAAN RLGYSEPTVY EFSMPPKPNI IKDTLFNGLG 
       710        720        730        740        750
LGAVIGLGVA ALLLILVVTD VSCFFIRQCG LLMCITRRMC GKKSGSSGKS 
       760        770        780        790        800
KELEEGKAAY LKDGSKEPIV EMRTEDERVT NHEDGSPVNE PNETTPLTEP 
       810        820        830 
EKLPLKEEDG KEALNPETIE IKVSNDIIQS KEDDSKA
Length:837
Mass (Da):93,046
Last modified:July 22, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i878EC1110562B3F3
GO
Isoform 2 (identifier: O15394-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MSLLLSFYLLGLLVSSGQ → MVRSDSGGQVYLDYHNRQGLFVDWKYNEALYLEEGQPETYYRT
     399-399: Y → S
     400-837: Missing.

Show »
Length:424
Mass (Da):47,551
Checksum:iD885280AE6FD66FA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9KV31H9KV31_HUMAN
Neural cell adhesion molecule 2
NCAM2
819Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti49E → R in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti72E → G in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti163F → L in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti374D → G in AAB80803 (PubMed:9226371).Curated1
Sequence conflicti662 – 667YEVQIT → MKFRLP in AAB80803 (PubMed:9226371).Curated6

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047897347D → N. Corresponds to variant dbSNP:rs35654962Ensembl.1
Natural variantiVAR_047898350L → P1 PublicationCorresponds to variant dbSNP:rs232518Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566371 – 18MSLLL…VSSGQ → MVRSDSGGQVYLDYHNRQGL FVDWKYNEALYLEEGQPETY YRT in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_056638399Y → S in isoform 2. 1 Publication1
Alternative sequenceiVSP_056639400 – 837Missing in isoform 2. 1 PublicationAdd BLAST438

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U75330 mRNA Translation: AAB80803.1
AK302870 mRNA Translation: BAH13827.1
AP001114 Genomic DNA No translation available.
AP001115 Genomic DNA No translation available.
AP001136 Genomic DNA No translation available.
AP001137 Genomic DNA No translation available.
AP001138 Genomic DNA No translation available.
AP001252 Genomic DNA No translation available.
BC052946 mRNA Translation: AAH52946.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS42910.1 [O15394-1]

NCBI Reference Sequences

More...RefSeqi		NP_004531.2, NM_004540.3 [O15394-1]
XP_016883847.1, XM_017028358.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000400546; ENSP00000383392; ENSG00000154654 [O15394-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4685

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4685

UCSC genome browser

More...UCSCi		uc002yld.3, human [O15394-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U75330 mRNA Translation: AAB80803.1
AK302870 mRNA Translation: BAH13827.1
AP001114 Genomic DNA No translation available.
AP001115 Genomic DNA No translation available.
AP001136 Genomic DNA No translation available.
AP001137 Genomic DNA No translation available.
AP001138 Genomic DNA No translation available.
AP001252 Genomic DNA No translation available.
BC052946 mRNA Translation: AAH52946.1
CCDSiCCDS42910.1 [O15394-1]
RefSeqiNP_004531.2, NM_004540.3 [O15394-1]
XP_016883847.1, XM_017028358.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DOCNMR-A486-591[»]
2JLLX-ray2.30A301-689[»]
2KBGNMR-A592-693[»]
2V5TX-ray2.00A115-301[»]
2VAJX-ray2.70A21-113[»]
2WIMX-ray3.00A/B19-301[»]
2XY1X-ray1.90A209-398[»]
2XY2X-ray1.77A19-207[»]
2XYCX-ray2.65A301-591[»]
SMRiO15394
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi110765, 5 interactors
DIPiDIP-56211N
IntActiO15394, 6 interactors
STRINGi9606.ENSP00000383392

PTM databases

GlyConnecti1546, 7 N-Linked glycans (3 sites)
GlyGeniO15394, 12 sites
iPTMnetiO15394
PhosphoSitePlusiO15394
SwissPalmiO15394

Genetic variation databases

BioMutaiNCAM2

Proteomic databases

jPOSTiO15394
MassIVEiO15394
MaxQBiO15394
PaxDbiO15394
PeptideAtlasiO15394
PRIDEiO15394
ProteomicsDBi48635 [O15394-1]
6923

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		22282, 287 antibodies

Genome annotation databases

EnsembliENST00000400546; ENSP00000383392; ENSG00000154654 [O15394-1]
GeneIDi4685
KEGGihsa:4685
UCSCiuc002yld.3, human [O15394-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4685
DisGeNETi4685

GeneCards: human genes, protein and diseases

More...GeneCardsi		NCAM2
HGNCiHGNC:7657, NCAM2
HPAiENSG00000154654, Tissue enhanced (adrenal gland, brain)
MIMi602040, gene
neXtProtiNX_O15394
OpenTargetsiENSG00000154654
PharmGKBiPA31460
VEuPathDBiHostDB:ENSG00000154654.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3510, Eukaryota
GeneTreeiENSGT00940000157860
InParanoidiO15394
OMAiHGGVPIN
OrthoDBi129648at2759
PhylomeDBiO15394
TreeFamiTF326195

Enzyme and pathway databases

PathwayCommonsiO15394

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		4685, 7 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NCAM2, human
EvolutionaryTraceiO15394

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4685
PharosiO15394, Tbio

Protein Ontology

More...PROi		PR:O15394
RNActiO15394, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000154654, Expressed in corpus callosum and 122 other tissues
ExpressionAtlasiO15394, baseline and differential
GenevisibleiO15394, HS

Family and domain databases

CDDicd00063, FN3, 2 hits
Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013106, Ig_V-set
IPR009138, Neural_cell_adh
PfamiView protein in Pfam
PF00041, fn3, 2 hits
PF07679, I-set, 4 hits
PRINTSiPR01838, NCAMFAMILY
SMARTiView protein in SMART
SM00060, FN3, 2 hits
SM00409, IG, 5 hits
SM00408, IGc2, 5 hits
SM00406, IGv, 3 hits
SUPFAMiSSF48726, SSF48726, 5 hits
SSF49265, SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853, FN3, 2 hits
PS50835, IG_LIKE, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCAM2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15394
Secondary accession number(s): A8MQ06, B7Z841, Q7Z7F2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 22, 2008
Last modified: February 10, 2021
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again