Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 191 (07 Oct 2020)
Sequence version 3 (03 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Transmembrane protease serine 2

Gene

TMPRSS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plasma membrane-anchored serine protease that participates in proteolytic cascades of relevance for the normal physiologic function of the prostate (PubMed:25122198). Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the protease activated receptor-2/F2RL1 or matriptase/ST14 leading to extracellular matrix disruption and metastasis of prostate cancer cells (PubMed:15537383, PubMed:26018085, PubMed:25122198). In addition, activates trigeminal neurons and contribute to both spontaneous pain and mechanical allodynia (By similarity).By similarity3 Publications
(Microbial infection) Facilitates human coronaviruses SARS-CoV and SARS-CoV-2 infections via two independent mechanisms, proteolytic cleavage of ACE2 receptor which promotes viral uptake, and cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry (PubMed:24227843, PubMed:32142651). Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.7 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei296Charge relay systemBy similarity1
Active sitei345Charge relay systemBy similarity1
Active sitei441Charge relay system1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
O15393

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15393

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S01.247

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protease serine 2Curated (EC:3.4.21.-)
Alternative name(s):
Serine protease 10Curated
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMPRSS2Imported
Synonyms:PRSS10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000184012.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11876, TMPRSS2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602060, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15393

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 84CytoplasmicSequence analysisAdd BLAST84
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei85 – 105Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini106 – 492ExtracellularSequence analysisAdd BLAST387

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi255R → Q: Loss of cleavage. 1 Publication1
Mutagenesisi441S → A: Loss of activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
7113

Open Targets

More...
OpenTargetsi
ENSG00000184012

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36577

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O15393, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1795140

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2421

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMPRSS2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000278551 – 255Transmembrane protease serine 2 non-catalytic chainAdd BLAST255
ChainiPRO_0000027856256 – 492Transmembrane protease serine 2 catalytic chainAdd BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi113 ↔ 126By similarity
Disulfide bondi120 ↔ 139By similarity
Disulfide bondi133 ↔ 148By similarity
Disulfide bondi172 ↔ 231By similarity
Disulfide bondi185 ↔ 241By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi213N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi244 ↔ 365Interchain (between non-catalytic and catalytic chains)PROSITE-ProRule annotation
Glycosylationi249N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi281 ↔ 297By similarity
Disulfide bondi410 ↔ 426By similarity
Disulfide bondi437 ↔ 465By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically processed; by an autocatalytic mechanism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei255 – 256Cleavage1 Publication2

Keywords - PTMi

Autocatalytic cleavage, Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15393

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O15393

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15393

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15393

PeptideAtlas

More...
PeptideAtlasi
O15393

PRoteomics IDEntifications database

More...
PRIDEi
O15393

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
31938
48634 [O15393-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1848, 4 N-Linked glycans (2 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
O15393, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15393

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15393

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O15393

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in several tissues that comprise large populations of epithelial cells with the highest level of transcripts measured in the prostate gland. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly in small intestine. Also expressed in colon, stomach and salivary gland. Coexpressed with ACE2 within lung type II pneumocytes, ileal absorptive enterocytes, intestinal epithelial cells, cornea, gallbladder and nasal goblet secretory cells (Ref. 21).4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By androgenic hormones in vivo.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184012, Expressed in prostate gland and 166 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15393, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15393, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000184012, Tissue enhanced (intestine, pancreas, prostate)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The catalytically active form interacts with ACE2.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

O15393
With#Exp.IntAct
ACE2 [Q9BYF1]3EBI-12549863,EBI-7730807
Isoform 2 [O15393-2]
With#Exp.IntAct
ADIPOQ [Q15848]3EBI-12345267,EBI-10827839
ANKRD46 - isoform 1 [Q86W74-2]3EBI-12345267,EBI-12109402
AQP1 [P29972]3EBI-12345267,EBI-745213
BMP10 [O95393]3EBI-12345267,EBI-3922513
BNIP2 [Q12982]3EBI-12345267,EBI-752094
BNIP3 [Q12983]3EBI-12345267,EBI-749464
BRICD5 - isoform 2 [Q6PL45-2]3EBI-12345267,EBI-12244618
C1QL4 [Q86Z23]3EBI-12345267,EBI-12062109
C2CD2L [O14523]3EBI-12345267,EBI-12822627
CFHR5 [Q9BXR6]3EBI-12345267,EBI-11579371
CLEC7A - isoform 6 [Q9BXN2-6]3EBI-12345267,EBI-11989440
CLN6 [Q9NWW5]3EBI-12345267,EBI-6165897
CMTM7 [Q96FZ5]3EBI-12345267,EBI-2807956
CNIH2 [Q6PI25]3EBI-12345267,EBI-12815321
CNIH3 [Q8TBE1]3EBI-12345267,EBI-12208021
CTXN3 [Q4LDR2]3EBI-12345267,EBI-12019274
CXCL9 [Q07325]3EBI-12345267,EBI-3911467
CYBC1 [Q9BQA9]3EBI-12345267,EBI-2680384
DEFB103B [P81534]3EBI-12345267,EBI-12074168
EDDM3B [P56851]3EBI-12345267,EBI-10215665
ERG28 [Q9UKR5]3EBI-12345267,EBI-711490
FAM3C [Q92520]3EBI-12345267,EBI-2876774
FAXDC2 [Q96IV6]3EBI-12345267,EBI-12142299
IGFBP5 [P24593]3EBI-12345267,EBI-720480
MFSD6 [Q6ZSS7]3EBI-12345267,EBI-2858252
MOSPD3 [O75425]3EBI-12345267,EBI-12179105
NINJ2 [Q9NZG7]3EBI-12345267,EBI-10317425
PGAP2 - isoform 5 [Q9UHJ9-5]3EBI-12345267,EBI-12092917
PLLP [Q9Y342]3EBI-12345267,EBI-3919291
PLN [P26678]3EBI-12345267,EBI-692836
PLP1 - isoform DM-20 [P60201-2]3EBI-12345267,EBI-12188331
PLP2 [Q04941]4EBI-12345267,EBI-608347
PTCH1 - isoform M [Q13635-3]3EBI-12345267,EBI-14199621
PTTG1IP [P53801]3EBI-12345267,EBI-3906138
SCD [O00767]4EBI-12345267,EBI-2684237
SEC22A [Q96IW7]3EBI-12345267,EBI-8652744
SELENOK [Q9Y6D0]3EBI-12345267,EBI-9679163
SFTPC [P11686]3EBI-12345267,EBI-10197617
SLC35A1 [P78382]3EBI-12345267,EBI-12870360
SLC38A7 [Q9NVC3]3EBI-12345267,EBI-10314552
SMIM1 [B2RUZ4]3EBI-12345267,EBI-12188413
STX7 [O15400]4EBI-12345267,EBI-3221827
STX8 [Q9UNK0]3EBI-12345267,EBI-727240
TMEM11 [P17152]3EBI-12345267,EBI-723946
TMEM120B [A0PK00]3EBI-12345267,EBI-10171534
TMEM128 - isoform 2 [Q5BJH2-2]3EBI-12345267,EBI-10694905
TMEM218 [A2RU14]3EBI-12345267,EBI-10173151
TMEM222 [Q9H0R3]3EBI-12345267,EBI-347385
TMEM229B [Q8NBD8]3EBI-12345267,EBI-12195227
TMEM243 [Q9BU79]3EBI-12345267,EBI-12887458
TMEM60 [Q9H2L4]3EBI-12345267,EBI-2852148
TMEM79 [Q9BSE2]3EBI-12345267,EBI-8649725
TMEM86A [Q8N2M4]3EBI-12345267,EBI-12015604
TMEM86B [Q8N661]3EBI-12345267,EBI-2548832
TNF [P01375]3EBI-12345267,EBI-359977
TTMP [Q5BVD1]5EBI-12345267,EBI-10243654
UPK2 [O00526]3EBI-12345267,EBI-10179682
VAMP5 [O95183]3EBI-12345267,EBI-10191195
VKORC1 [Q9BQB6]3EBI-12345267,EBI-6256462
ZFPL1 [O95159]3EBI-12345267,EBI-718439

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
112968, 65 interactors

Protein interaction database and analysis system

More...
IntActi
O15393, 61 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000381588

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
O15393

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
O15393, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15393

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini112 – 149LDL-receptor class APROSITE-ProRule annotationAdd BLAST38
Domaini150 – 242SRCRPROSITE-ProRule annotationAdd BLAST93
Domaini256 – 489Peptidase S1PROSITE-ProRule annotationAdd BLAST234

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3627, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155207

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15393

KEGG Orthology (KO)

More...
KOi
K09633

Identification of Orthologs from Complete Genome Data

More...
OMAi
YQPESLY

Database of Orthologous Groups

More...
OrthoDBi
1314811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15393

TreeFam database of animal gene trees

More...
TreeFami
TF351678

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112, LDLa, 1 hit
cd00190, Tryp_SPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.10.10, 1 hit
3.10.250.10, 1 hit
4.10.400.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036055, LDL_receptor-like_sf
IPR023415, LDLR_class-A_CS
IPR002172, LDrepeatLR_classA_rpt
IPR009003, Peptidase_S1_PA
IPR043504, Peptidase_S1_PA_chymotrypsin
IPR001314, Peptidase_S1A
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf
IPR001254, Trypsin_dom
IPR018114, TRYPSIN_HIS
IPR033116, TRYPSIN_SER

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15494, SRCR_2, 1 hit
PF00089, Trypsin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00722, CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00192, LDLa, 1 hit
SM00202, SR, 1 hit
SM00020, Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50494, SSF50494, 1 hit
SSF56487, SSF56487, 1 hit
SSF57424, SSF57424, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01209, LDLRA_1, 1 hit
PS50068, LDLRA_2, 1 hit
PS50287, SRCR_2, 1 hit
PS50240, TRYPSIN_DOM, 1 hit
PS00134, TRYPSIN_HIS, 1 hit
PS00135, TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15393-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALNSGSPPA IGPYYENHGY QPENPYPAQP TVVPTVYEVH PAQYYPSPVP
60 70 80 90 100
QYAPRVLTQA SNPVVCTQPK SPSGTVCTSK TKKALCITLT LGTFLVGAAL
110 120 130 140 150
AAGLLWKFMG SKCSNSGIEC DSSGTCINPS NWCDGVSHCP GGEDENRCVR
160 170 180 190 200
LYGPNFILQV YSSQRKSWHP VCQDDWNENY GRAACRDMGY KNNFYSSQGI
210 220 230 240 250
VDDSGSTSFM KLNTSAGNVD IYKKLYHSDA CSSKAVVSLR CIACGVNLNS
260 270 280 290 300
SRQSRIVGGE SALPGAWPWQ VSLHVQNVHV CGGSIITPEW IVTAAHCVEK
310 320 330 340 350
PLNNPWHWTA FAGILRQSFM FYGAGYQVEK VISHPNYDSK TKNNDIALMK
360 370 380 390 400
LQKPLTFNDL VKPVCLPNPG MMLQPEQLCW ISGWGATEEK GKTSEVLNAA
410 420 430 440 450
KVLLIETQRC NSRYVYDNLI TPAMICAGFL QGNVDSCQGD SGGPLVTSKN
460 470 480 490
NIWWLIGDTS WGSGCAKAYR PGVYGNVMVF TDWIYRQMRA DG
Length:492
Mass (Da):53,859
Last modified:October 3, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC05B5531C8A311C7
GO
Isoform 2 (identifier: O15393-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKM

Show »
Length:529
Mass (Da):57,690
Checksum:i444EBB1FFF3ACDFA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JKZ3C9JKZ3_HUMAN
Transmembrane protease serine 2
TMPRSS2
489Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5Y1C9J5Y1_HUMAN
Transmembrane protease serine 2
TMPRSS2
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JB05C9JB05_HUMAN
Transmembrane protease serine 2
TMPRSS2
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26Y → H in BAF84502 (PubMed:14702039).Curated1
Sequence conflicti62N → S in BAH12445 (PubMed:14702039).Curated1
Sequence conflicti163S → P in BAF84502 (PubMed:14702039).Curated1
Sequence conflicti242I → L in AAC51784 (PubMed:9325052).Curated1
Sequence conflicti489 – 491RAD → KAN in AAC51784 (PubMed:9325052).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027674160V → M3 PublicationsCorresponds to variant dbSNP:rs12329760Ensembl.1
Natural variantiVAR_038002254S → C1 Publication1
Natural variantiVAR_038003329E → Q2 PublicationsCorresponds to variant dbSNP:rs775137340Ensembl.1
Natural variantiVAR_011692449K → N. Corresponds to variant dbSNP:rs1056602Ensembl.1
Natural variantiVAR_038004491D → N1 PublicationCorresponds to variant dbSNP:rs779875214Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0450831M → MPPAPPGGESGCEERGAAGH IEHSRYLSLLDAVDNSKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U75329 mRNA Translation: AAC51784.1
AF123453 mRNA Translation: AAD37117.1
AF270487 mRNA Translation: AAK29280.1
AK291813 mRNA Translation: BAF84502.1
AK296860 mRNA Translation: BAH12445.1
AK313338 mRNA Translation: BAG36142.1
AK222784 mRNA Translation: BAD96504.1
AP001610 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09597.1
CH471079 Genomic DNA Translation: EAX09598.1
BC051839 mRNA Translation: AAH51839.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33564.1 [O15393-1]
CCDS54486.1 [O15393-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001128571.1, NM_001135099.1 [O15393-2]
NP_005647.3, NM_005656.3 [O15393-1]
XP_011528033.1, XM_011529731.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332149; ENSP00000330330; ENSG00000184012 [O15393-1]
ENST00000398585; ENSP00000381588; ENSG00000184012 [O15393-2]
ENST00000458356; ENSP00000391216; ENSG00000184012 [O15393-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7113

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7113

UCSC genome browser

More...
UCSCi
uc002yzj.4, human [O15393-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U75329 mRNA Translation: AAC51784.1
AF123453 mRNA Translation: AAD37117.1
AF270487 mRNA Translation: AAK29280.1
AK291813 mRNA Translation: BAF84502.1
AK296860 mRNA Translation: BAH12445.1
AK313338 mRNA Translation: BAG36142.1
AK222784 mRNA Translation: BAD96504.1
AP001610 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09597.1
CH471079 Genomic DNA Translation: EAX09598.1
BC051839 mRNA Translation: AAH51839.1
CCDSiCCDS33564.1 [O15393-1]
CCDS54486.1 [O15393-2]
RefSeqiNP_001128571.1, NM_001135099.1 [O15393-2]
NP_005647.3, NM_005656.3 [O15393-1]
XP_011528033.1, XM_011529731.2

3D structure databases

SMRiO15393
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi112968, 65 interactors
IntActiO15393, 61 interactors
STRINGi9606.ENSP00000381588

Chemistry databases

BindingDBiO15393
ChEMBLiCHEMBL1795140
GuidetoPHARMACOLOGYi2421

Protein family/group databases

MEROPSiS01.247

PTM databases

GlyConnecti1848, 4 N-Linked glycans (2 sites)
GlyGeniO15393, 2 sites
iPTMnetiO15393
PhosphoSitePlusiO15393
SwissPalmiO15393

Polymorphism and mutation databases

BioMutaiTMPRSS2

Proteomic databases

jPOSTiO15393
MassIVEiO15393
MaxQBiO15393
PaxDbiO15393
PeptideAtlasiO15393
PRIDEiO15393
ProteomicsDBi31938
48634 [O15393-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
O15393, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2685, 293 antibodies

The DNASU plasmid repository

More...
DNASUi
7113

Genome annotation databases

EnsembliENST00000332149; ENSP00000330330; ENSG00000184012 [O15393-1]
ENST00000398585; ENSP00000381588; ENSG00000184012 [O15393-2]
ENST00000458356; ENSP00000391216; ENSG00000184012 [O15393-1]
GeneIDi7113
KEGGihsa:7113
UCSCiuc002yzj.4, human [O15393-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7113
DisGeNETi7113
EuPathDBiHostDB:ENSG00000184012.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMPRSS2
HGNCiHGNC:11876, TMPRSS2
HPAiENSG00000184012, Tissue enhanced (intestine, pancreas, prostate)
MIMi602060, gene
neXtProtiNX_O15393
OpenTargetsiENSG00000184012
PharmGKBiPA36577

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3627, Eukaryota
GeneTreeiENSGT00940000155207
InParanoidiO15393
KOiK09633
OMAiYQPESLY
OrthoDBi1314811at2759
PhylomeDBiO15393
TreeFamiTF351678

Enzyme and pathway databases

PathwayCommonsiO15393
SIGNORiO15393

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
7113, 2 hits in 872 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMPRSS2, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TMPRSS2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7113
PharosiO15393, Tchem

Protein Ontology

More...
PROi
PR:O15393
RNActiO15393, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184012, Expressed in prostate gland and 166 other tissues
ExpressionAtlasiO15393, baseline and differential
GenevisibleiO15393, HS

Family and domain databases

CDDicd00112, LDLa, 1 hit
cd00190, Tryp_SPc, 1 hit
Gene3Di2.40.10.10, 1 hit
3.10.250.10, 1 hit
4.10.400.10, 1 hit
InterProiView protein in InterPro
IPR036055, LDL_receptor-like_sf
IPR023415, LDLR_class-A_CS
IPR002172, LDrepeatLR_classA_rpt
IPR009003, Peptidase_S1_PA
IPR043504, Peptidase_S1_PA_chymotrypsin
IPR001314, Peptidase_S1A
IPR001190, SRCR
IPR017448, SRCR-like_dom
IPR036772, SRCR-like_dom_sf
IPR001254, Trypsin_dom
IPR018114, TRYPSIN_HIS
IPR033116, TRYPSIN_SER
PfamiView protein in Pfam
PF15494, SRCR_2, 1 hit
PF00089, Trypsin, 1 hit
PRINTSiPR00722, CHYMOTRYPSIN
SMARTiView protein in SMART
SM00192, LDLa, 1 hit
SM00202, SR, 1 hit
SM00020, Tryp_SPc, 1 hit
SUPFAMiSSF50494, SSF50494, 1 hit
SSF56487, SSF56487, 1 hit
SSF57424, SSF57424, 1 hit
PROSITEiView protein in PROSITE
PS01209, LDLRA_1, 1 hit
PS50068, LDLRA_2, 1 hit
PS50287, SRCR_2, 1 hit
PS50240, TRYPSIN_DOM, 1 hit
PS00134, TRYPSIN_HIS, 1 hit
PS00135, TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMPS2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15393
Secondary accession number(s): A8K6Z8
, B2R8E5, B7Z459, D3DSJ2, F8WES1, Q6GTK7, Q9BXX1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: October 3, 2006
Last modified: October 7, 2020
This is version 191 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again