Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Monocarboxylate transporter 6

Gene

SLC16A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

  • monocarboxylic acid transmembrane transporter activity Source: GO_Central
  • symporter activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processSymport, Transport

Protein family/group databases

TCDBi2.A.1.13.11 the major facilitator superfamily (mfs)

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 6
Short name:
MCT 6
Alternative name(s):
Monocarboxylate transporter 5
Short name:
MCT 5
Solute carrier family 16 member 5
Gene namesi
Name:SLC16A5
Synonyms:MCT5, MCT6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000170190.15
HGNCiHGNC:10926 SLC16A5
MIMi603879 gene
neXtProtiNX_O15375

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 17CytoplasmicSequence analysisAdd BLAST17
Transmembranei18 – 38HelicalSequence analysisAdd BLAST21
Topological domaini39 – 53ExtracellularSequence analysisAdd BLAST15
Transmembranei54 – 74HelicalSequence analysisAdd BLAST21
Topological domaini75 – 80CytoplasmicSequence analysis6
Transmembranei81 – 101HelicalSequence analysisAdd BLAST21
Topological domaini102 – 110ExtracellularSequence analysis9
Transmembranei111 – 131HelicalSequence analysisAdd BLAST21
Topological domaini132 – 137CytoplasmicSequence analysis6
Transmembranei138 – 158HelicalSequence analysisAdd BLAST21
Topological domaini159 – 171ExtracellularSequence analysisAdd BLAST13
Transmembranei172 – 192HelicalSequence analysisAdd BLAST21
Topological domaini193 – 239CytoplasmicSequence analysisAdd BLAST47
Transmembranei240 – 260HelicalSequence analysisAdd BLAST21
Topological domaini261 – 274ExtracellularSequence analysisAdd BLAST14
Transmembranei275 – 295HelicalSequence analysisAdd BLAST21
Topological domaini296 – 305CytoplasmicSequence analysis10
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21
Topological domaini327 – 329ExtracellularSequence analysis3
Transmembranei330 – 350HelicalSequence analysisAdd BLAST21
Topological domaini351 – 367CytoplasmicSequence analysisAdd BLAST17
Transmembranei368 – 388HelicalSequence analysisAdd BLAST21
Topological domaini389 – 396ExtracellularSequence analysis8
Transmembranei397 – 417HelicalSequence analysisAdd BLAST21
Topological domaini418 – 505CytoplasmicSequence analysisAdd BLAST88

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9121
OpenTargetsiENSG00000170190
PharmGKBiPA35817

Chemistry databases

DrugBankiDB00119 Pyruvic acid

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002113991 – 505Monocarboxylate transporter 6Add BLAST505

Proteomic databases

MaxQBiO15375
PaxDbiO15375
PeptideAtlasiO15375
PRIDEiO15375
ProteomicsDBi48617

PTM databases

iPTMnetiO15375
PhosphoSitePlusiO15375

Expressioni

Tissue specificityi

Highly expressed in kidney.

Gene expression databases

BgeeiENSG00000170190 Expressed in 163 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_SLC16A5
ExpressionAtlasiO15375 baseline and differential
GenevisibleiO15375 HS

Interactioni

Protein-protein interaction databases

BioGridi114569, 1 interactor
IntActiO15375, 2 interactors
STRINGi9606.ENSP00000330141

Structurei

3D structure databases

ProteinModelPortaliO15375
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2504 Eukaryota
COG0477 LUCA
GeneTreeiENSGT00760000118926
HOGENOMiHOG000280688
HOVERGENiHBG006384
InParanoidiO15375
KOiK08182
OMAiHCCVCGA
OrthoDBiEOG091G05SW
PhylomeDBiO15375
TreeFamiTF313792

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR004743 MCT
IPR030760 MCT6
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PANTHERiPTHR11360:SF21 PTHR11360:SF21, 1 hit
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00892 2A0113, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15375-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQALERADG SWAWVVLLAT MVTQGLTLGF PTCIGIFFTE LQWEFQASNS
60 70 80 90 100
ETSWFPSILT AVLHMAGPLC SILVGRFGCR VTVMLGGVLA SLGMVASSFS
110 120 130 140 150
HNLSQLYFTA GFITGLGMCF SFQSSITVLG FYFVRRRVLA NALASMGVSL
160 170 180 190 200
GITLWPLLSR YLLENLGWRG TFLVFGGIFL HCCICGAIIR PVATSVAPET
210 220 230 240 250
KECPPPPPET PALGCLAACG RTIQRHLAFD ILRHNTGYCV YILGVMWSVL
260 270 280 290 300
GFPLPQVFLV PYAMWHSVDE QQAALLISII GFSNIFLRPL AGLMAGRPAF
310 320 330 340 350
ASHRKYLFSL ALLLNGLTNL VCAASGDFWV LVGYCLAYSV SMSGIGALIF
360 370 380 390 400
QVLMDIVPMD QFPRALGLFT VLDGLAFLIS PPLAGLLLDA TNNFSYVFYM
410 420 430 440 450
SSFFLISAAL FMGGSFYALQ KKEQGKQAVA ADALERDLFL EAKDGPGKQR
460 470 480 490 500
SPEIMCQSSR QPRPAGVNKH LWGCPASSRT SHEWLLWPKA VLQAKQTALG

WNSPT
Length:505
Mass (Da):54,994
Last modified:January 1, 1998 - v1
Checksum:iE0F7B4BD607D2364
GO
Isoform 2 (identifier: O15375-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPRPTRGPLATSQGWCPSVTPGTWAAATLAVRPWQRRQQRM
     456-505: CQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT → YVTSV

Note: No experimental confirmation available.
Show »
Length:500
Mass (Da):54,449
Checksum:i04108AC8476765C6
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QL40J3QL40_HUMAN
Monocarboxylate transporter 6
SLC16A5
454Annotation score:
J3QQW5J3QQW5_HUMAN
Monocarboxylate transporter 6
SLC16A5
236Annotation score:
J3KS19J3KS19_HUMAN
Monocarboxylate transporter 6
SLC16A5
203Annotation score:
J3KT93J3KT93_HUMAN
Monocarboxylate transporter 6
SLC16A5
53Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566601M → MPRPTRGPLATSQGWCPSVT PGTWAAATLAVRPWQRRQQR M in isoform 2. 1 Publication1
Alternative sequenceiVSP_056661456 – 505CQSSR…WNSPT → YVTSV in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59299 mRNA Translation: AAC52013.1
AK304163 mRNA Translation: BAG65050.1
AC111186 Genomic DNA No translation available.
BC009684 mRNA Translation: AAH09684.1
BC033611 mRNA Translation: AAH33611.1
CCDSiCCDS11713.1 [O15375-1]
RefSeqiNP_001258694.1, NM_001271765.1 [O15375-1]
NP_004686.1, NM_004695.3 [O15375-1]
UniGeneiHs.592095

Genome annotation databases

EnsembliENST00000329783; ENSP00000330141; ENSG00000170190 [O15375-1]
ENST00000450736; ENSP00000390564; ENSG00000170190 [O15375-1]
ENST00000538213; ENSP00000440212; ENSG00000170190 [O15375-2]
ENST00000580123; ENSP00000463434; ENSG00000170190 [O15375-1]
GeneIDi9121
KEGGihsa:9121
UCSCiuc002jmr.5 human [O15375-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59299 mRNA Translation: AAC52013.1
AK304163 mRNA Translation: BAG65050.1
AC111186 Genomic DNA No translation available.
BC009684 mRNA Translation: AAH09684.1
BC033611 mRNA Translation: AAH33611.1
CCDSiCCDS11713.1 [O15375-1]
RefSeqiNP_001258694.1, NM_001271765.1 [O15375-1]
NP_004686.1, NM_004695.3 [O15375-1]
UniGeneiHs.592095

3D structure databases

ProteinModelPortaliO15375
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114569, 1 interactor
IntActiO15375, 2 interactors
STRINGi9606.ENSP00000330141

Chemistry databases

DrugBankiDB00119 Pyruvic acid

Protein family/group databases

TCDBi2.A.1.13.11 the major facilitator superfamily (mfs)

PTM databases

iPTMnetiO15375
PhosphoSitePlusiO15375

Proteomic databases

MaxQBiO15375
PaxDbiO15375
PeptideAtlasiO15375
PRIDEiO15375
ProteomicsDBi48617

Protocols and materials databases

DNASUi9121
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329783; ENSP00000330141; ENSG00000170190 [O15375-1]
ENST00000450736; ENSP00000390564; ENSG00000170190 [O15375-1]
ENST00000538213; ENSP00000440212; ENSG00000170190 [O15375-2]
ENST00000580123; ENSP00000463434; ENSG00000170190 [O15375-1]
GeneIDi9121
KEGGihsa:9121
UCSCiuc002jmr.5 human [O15375-1]

Organism-specific databases

CTDi9121
DisGeNETi9121
EuPathDBiHostDB:ENSG00000170190.15
GeneCardsiSLC16A5
HGNCiHGNC:10926 SLC16A5
MIMi603879 gene
neXtProtiNX_O15375
OpenTargetsiENSG00000170190
PharmGKBiPA35817
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2504 Eukaryota
COG0477 LUCA
GeneTreeiENSGT00760000118926
HOGENOMiHOG000280688
HOVERGENiHBG006384
InParanoidiO15375
KOiK08182
OMAiHCCVCGA
OrthoDBiEOG091G05SW
PhylomeDBiO15375
TreeFamiTF313792

Miscellaneous databases

ChiTaRSiSLC16A5 human
GenomeRNAii9121
PROiPR:O15375
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170190 Expressed in 163 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_SLC16A5
ExpressionAtlasiO15375 baseline and differential
GenevisibleiO15375 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR004743 MCT
IPR030760 MCT6
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PANTHERiPTHR11360:SF21 PTHR11360:SF21, 1 hit
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00892 2A0113, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMOT6_HUMAN
AccessioniPrimary (citable) accession number: O15375
Secondary accession number(s): B4E288
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again