Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Monocarboxylate transporter 5

Gene

SLC16A4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

  • monocarboxylic acid transmembrane transporter activity Source: GO_Central
  • symporter activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processSymport, Transport

Enzyme and pathway databases

SIGNORiO15374

Protein family/group databases

TCDBi2.A.1.13.7 the major facilitator superfamily (mfs)

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Alternative name(s):
Monocarboxylate transporter 4
Short name:
MCT 4
Solute carrier family 16 member 4
Gene namesi
Name:SLC16A4
Synonyms:MCT4, MCT5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000168679.17
HGNCiHGNC:10925 SLC16A4
MIMi603878 gene
neXtProtiNX_O15374

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 16CytoplasmicSequence analysisAdd BLAST16
Transmembranei17 – 37HelicalSequence analysisAdd BLAST21
Topological domaini38 – 59ExtracellularSequence analysisAdd BLAST22
Transmembranei60 – 80HelicalSequence analysisAdd BLAST21
Topological domaini81 – 87CytoplasmicSequence analysis7
Transmembranei88 – 108HelicalSequence analysisAdd BLAST21
Topological domaini109ExtracellularSequence analysis1
Transmembranei110 – 129HelicalSequence analysisAdd BLAST20
Topological domaini130 – 143CytoplasmicSequence analysisAdd BLAST14
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Topological domaini165 – 174ExtracellularSequence analysis10
Transmembranei175 – 195HelicalSequence analysisAdd BLAST21
Topological domaini196 – 299CytoplasmicSequence analysisAdd BLAST104
Transmembranei300 – 320HelicalSequence analysisAdd BLAST21
Topological domaini321 – 337ExtracellularSequence analysisAdd BLAST17
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 372CytoplasmicSequence analysisAdd BLAST14
Transmembranei373 – 393HelicalSequence analysisAdd BLAST21
Topological domaini394ExtracellularSequence analysis1
Transmembranei395 – 415HelicalSequence analysisAdd BLAST21
Topological domaini416 – 425CytoplasmicSequence analysis10
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 458ExtracellularSequence analysisAdd BLAST12
Transmembranei459 – 479HelicalSequence analysisAdd BLAST21
Topological domaini480 – 487CytoplasmicSequence analysis8

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9122
OpenTargetsiENSG00000168679
PharmGKBiPA35816

Chemistry databases

DrugBankiDB00119 Pyruvic acid

Polymorphism and mutation databases

BioMutaiSLC16A4

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002113981 – 487Monocarboxylate transporter 5Add BLAST487

Proteomic databases

MaxQBiO15374
PaxDbiO15374
PeptideAtlasiO15374
PRIDEiO15374
ProteomicsDBi48616

PTM databases

iPTMnetiO15374
PhosphoSitePlusiO15374

Expressioni

Gene expression databases

BgeeiENSG00000168679 Expressed in 176 organ(s), highest expression level in palpebral conjunctiva
CleanExiHS_SLC16A4
ExpressionAtlasiO15374 baseline and differential
GenevisibleiO15374 HS

Organism-specific databases

HPAiHPA046986
HPA060163

Interactioni

Protein-protein interaction databases

BioGridi114570, 2 interactors
IntActiO15374, 3 interactors
MINTiO15374

Structurei

3D structure databases

ProteinModelPortaliO15374
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IMVW Eukaryota
ENOG410ZITK LUCA
GeneTreeiENSGT00910000144077
HOGENOMiHOG000059591
HOVERGENiHBG006385
InParanoidiO15374
KOiK08181
OMAiYTQTYTG
OrthoDBiEOG091G07PG
PhylomeDBiO15374
TreeFamiTF313792

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15374-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE
60 70 80 90 100
EFEGTSEQIG WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG
110 120 130 140 150
YLISSWATSI PFLCVTMGLL PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI
160 170 180 190 200
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIALNLVP SSMLLRPIHI
210 220 230 240 250
KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS TTQKAGLPSK
260 270 280 290 300
NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF
310 320 330 340 350
FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS
360 370 380 390 400
QIISGWVADQ NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA
410 420 430 440 450
IFAGGYLALI LPVLVDLCRN STVNRFLGLA SFFAGMAVLS GPPIAGWLYD
460 470 480
YTQTYNGSFY FSGICYLLSS VSFFFVPLAE RWKNSLT
Length:487
Mass (Da):54,022
Last modified:January 1, 1998 - v1
Checksum:i3CF236C69CC29631
GO
Isoform 2 (identifier: O15374-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP

Note: No experimental confirmation available.
Show »
Length:425
Mass (Da):46,866
Checksum:i65F0F0C131B01F0F
GO
Isoform 3 (identifier: O15374-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-343: Missing.

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):35,362
Checksum:i3B8F0394C218236F
GO
Isoform 4 (identifier: O15374-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
     446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV

Note: No experimental confirmation available.
Show »
Length:382
Mass (Da):42,347
Checksum:i76C55A1F6BE75D4A
GO
Isoform 5 (identifier: O15374-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-121: Missing.

Note: No experimental confirmation available.
Show »
Length:439
Mass (Da):49,100
Checksum:i7ABA00B613731D36
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YEG4H0YEG4_HUMAN
Monocarboxylate transporter 5
SLC16A4
219Annotation score:
E9PRV1E9PRV1_HUMAN
Monocarboxylate transporter 5
SLC16A4
42Annotation score:
E9PKZ1E9PKZ1_HUMAN
Monocarboxylate transporter 5
SLC16A4
57Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25I → V in BAF83409 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053655185A → T. Corresponds to variant dbSNP:rs35157487Ensembl.1
Natural variantiVAR_020309264N → H1 PublicationCorresponds to variant dbSNP:rs2271885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0464561 – 120MLKRE…TMGLL → MGMDDCDSFF in isoform 4. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0462421 – 34Missing in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04624338 – 73TKTFA…LRFCA → DDCDSFFP in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_04645774 – 121Missing in isoform 5. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_046244176 – 343Missing in isoform 3. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_046458446 – 487GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59185 mRNA Translation: AAB72035.1
AK290720 mRNA Translation: BAF83409.1
AK295946 mRNA Translation: BAG58729.1
AK298539 mRNA Translation: BAG60739.1
AK313735 mRNA Translation: BAG36476.1
AL355488 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56443.1
CH471122 Genomic DNA Translation: EAW56445.1
CH471122 Genomic DNA Translation: EAW56446.1
BC021664 mRNA Translation: AAH21664.1
CCDSiCCDS55621.1 [O15374-4]
CCDS55622.1 [O15374-2]
CCDS55623.1 [O15374-5]
CCDS55624.1 [O15374-3]
CCDS823.1 [O15374-1]
RefSeqiNP_001188475.1, NM_001201546.1 [O15374-5]
NP_001188476.1, NM_001201547.1 [O15374-2]
NP_001188477.1, NM_001201548.1 [O15374-4]
NP_001188478.1, NM_001201549.1 [O15374-3]
NP_004687.1, NM_004696.2 [O15374-1]
XP_005271374.1, XM_005271317.4 [O15374-1]
UniGeneiHs.351306

Genome annotation databases

EnsembliENST00000369779; ENSP00000358794; ENSG00000168679 [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679 [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679 [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679 [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679 [O15374-2]
GeneIDi9122
KEGGihsa:9122
UCSCiuc001dzo.3 human [O15374-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59185 mRNA Translation: AAB72035.1
AK290720 mRNA Translation: BAF83409.1
AK295946 mRNA Translation: BAG58729.1
AK298539 mRNA Translation: BAG60739.1
AK313735 mRNA Translation: BAG36476.1
AL355488 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56443.1
CH471122 Genomic DNA Translation: EAW56445.1
CH471122 Genomic DNA Translation: EAW56446.1
BC021664 mRNA Translation: AAH21664.1
CCDSiCCDS55621.1 [O15374-4]
CCDS55622.1 [O15374-2]
CCDS55623.1 [O15374-5]
CCDS55624.1 [O15374-3]
CCDS823.1 [O15374-1]
RefSeqiNP_001188475.1, NM_001201546.1 [O15374-5]
NP_001188476.1, NM_001201547.1 [O15374-2]
NP_001188477.1, NM_001201548.1 [O15374-4]
NP_001188478.1, NM_001201549.1 [O15374-3]
NP_004687.1, NM_004696.2 [O15374-1]
XP_005271374.1, XM_005271317.4 [O15374-1]
UniGeneiHs.351306

3D structure databases

ProteinModelPortaliO15374
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114570, 2 interactors
IntActiO15374, 3 interactors
MINTiO15374

Chemistry databases

DrugBankiDB00119 Pyruvic acid

Protein family/group databases

TCDBi2.A.1.13.7 the major facilitator superfamily (mfs)

PTM databases

iPTMnetiO15374
PhosphoSitePlusiO15374

Polymorphism and mutation databases

BioMutaiSLC16A4

Proteomic databases

MaxQBiO15374
PaxDbiO15374
PeptideAtlasiO15374
PRIDEiO15374
ProteomicsDBi48616

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369779; ENSP00000358794; ENSG00000168679 [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679 [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679 [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679 [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679 [O15374-2]
GeneIDi9122
KEGGihsa:9122
UCSCiuc001dzo.3 human [O15374-1]

Organism-specific databases

CTDi9122
DisGeNETi9122
EuPathDBiHostDB:ENSG00000168679.17
GeneCardsiSLC16A4
HGNCiHGNC:10925 SLC16A4
HPAiHPA046986
HPA060163
MIMi603878 gene
neXtProtiNX_O15374
OpenTargetsiENSG00000168679
PharmGKBiPA35816
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMVW Eukaryota
ENOG410ZITK LUCA
GeneTreeiENSGT00910000144077
HOGENOMiHOG000059591
HOVERGENiHBG006385
InParanoidiO15374
KOiK08181
OMAiYTQTYTG
OrthoDBiEOG091G07PG
PhylomeDBiO15374
TreeFamiTF313792

Enzyme and pathway databases

SIGNORiO15374

Miscellaneous databases

GeneWikiiSLC16A4
GenomeRNAii9122
PROiPR:O15374
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168679 Expressed in 176 organ(s), highest expression level in palpebral conjunctiva
CleanExiHS_SLC16A4
ExpressionAtlasiO15374 baseline and differential
GenevisibleiO15374 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMOT5_HUMAN
AccessioniPrimary (citable) accession number: O15374
Secondary accession number(s): A8K3V5
, B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again