Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Monocarboxylate transporter 5

Gene

SLC16A4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • monocarboxylic acid transmembrane transporter activity Source: GO_Central
  • symporter activity Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSymport, Transport

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15374

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.1.13.7 the major facilitator superfamily (mfs)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Alternative name(s):
Monocarboxylate transporter 4
Short name:
MCT 4
Solute carrier family 16 member 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC16A4
Synonyms:MCT4, MCT5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168679.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10925 SLC16A4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603878 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15374

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 16CytoplasmicSequence analysisAdd BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei17 – 37HelicalSequence analysisAdd BLAST21
Topological domaini38 – 59ExtracellularSequence analysisAdd BLAST22
Transmembranei60 – 80HelicalSequence analysisAdd BLAST21
Topological domaini81 – 87CytoplasmicSequence analysis7
Transmembranei88 – 108HelicalSequence analysisAdd BLAST21
Topological domaini109ExtracellularSequence analysis1
Transmembranei110 – 129HelicalSequence analysisAdd BLAST20
Topological domaini130 – 143CytoplasmicSequence analysisAdd BLAST14
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Topological domaini165 – 174ExtracellularSequence analysis10
Transmembranei175 – 195HelicalSequence analysisAdd BLAST21
Topological domaini196 – 299CytoplasmicSequence analysisAdd BLAST104
Transmembranei300 – 320HelicalSequence analysisAdd BLAST21
Topological domaini321 – 337ExtracellularSequence analysisAdd BLAST17
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 372CytoplasmicSequence analysisAdd BLAST14
Transmembranei373 – 393HelicalSequence analysisAdd BLAST21
Topological domaini394ExtracellularSequence analysis1
Transmembranei395 – 415HelicalSequence analysisAdd BLAST21
Topological domaini416 – 425CytoplasmicSequence analysis10
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 458ExtracellularSequence analysisAdd BLAST12
Transmembranei459 – 479HelicalSequence analysisAdd BLAST21
Topological domaini480 – 487CytoplasmicSequence analysis8

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9122

Open Targets

More...
OpenTargetsi
ENSG00000168679

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35816

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00119 Pyruvic acid

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC16A4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002113981 – 487Monocarboxylate transporter 5Add BLAST487

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15374

MaxQB - The MaxQuant DataBase

More...
MaxQBi
O15374

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15374

PeptideAtlas

More...
PeptideAtlasi
O15374

PRoteomics IDEntifications database

More...
PRIDEi
O15374

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48616

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15374

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15374

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168679 Expressed in 176 organ(s), highest expression level in palpebral conjunctiva

CleanEx database of gene expression profiles

More...
CleanExi
HS_SLC16A4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15374 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15374 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046986
HPA060163

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114570, 2 interactors

Protein interaction database and analysis system

More...
IntActi
O15374, 3 interactors

Molecular INTeraction database

More...
MINTi
O15374

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15374

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMVW Eukaryota
ENOG410ZITK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158411

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059591

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG006385

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15374

KEGG Orthology (KO)

More...
KOi
K08181

Identification of Orthologs from Complete Genome Data

More...
OMAi
YTQTYTG

Database of Orthologous Groups

More...
OrthoDBi
916876at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15374

TreeFam database of animal gene trees

More...
TreeFami
TF313792

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06174 MFS, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07690 MFS_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473 SSF103473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850 MFS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15374-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKREGKVQP YTKTLDGGWG WMIVIHFFLV NVFVMGMTKT FAIFFVVFQE
60 70 80 90 100
EFEGTSEQIG WIGSIMSSLR FCAGPLVAII CDILGEKTTS ILGAFVVTGG
110 120 130 140 150
YLISSWATSI PFLCVTMGLL PGLGSAFLYQ VAAVVTTKYF KKRLALSTAI
160 170 180 190 200
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIALNLVP SSMLLRPIHI
210 220 230 240 250
KSENNSGIKD KGSSLSAHGP EAHATETHCH ETEESTIKDS TTQKAGLPSK
260 270 280 290 300
NLTVSQNQSE EFYNGPNRNR LLLKSDEESD KVISWSCKQL FDISLFRNPF
310 320 330 340 350
FYIFTWSFLL SQLAYFIPTF HLVARAKTLG IDIMDASYLV SVAGILETVS
360 370 380 390 400
QIISGWVADQ NWIKKYHYHK SYLILCGITN LLAPLATTFP LLMTYTICFA
410 420 430 440 450
IFAGGYLALI LPVLVDLCRN STVNRFLGLA SFFAGMAVLS GPPIAGWLYD
460 470 480
YTQTYNGSFY FSGICYLLSS VSFFFVPLAE RWKNSLT
Length:487
Mass (Da):54,022
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3CF236C69CC29631
GO
Isoform 2 (identifier: O15374-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     38-73: TKTFAIFFVVFQEEFEGTSEQIGWIGSIMSSLRFCA → DDCDSFFP

Note: No experimental confirmation available.
Show »
Length:425
Mass (Da):46,866
Checksum:i65F0F0C131B01F0F
GO
Isoform 3 (identifier: O15374-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-343: Missing.

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):35,362
Checksum:i3B8F0394C218236F
GO
Isoform 4 (identifier: O15374-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-120: MLKREGKVQP...PFLCVTMGLL → MGMDDCDSFF
     446-487: GWLYDYTQTY...LAERWKNSLT → EIIPSFQAGY...YHWPKDGKTV

Note: No experimental confirmation available.
Show »
Length:382
Mass (Da):42,347
Checksum:i76C55A1F6BE75D4A
GO
Isoform 5 (identifier: O15374-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-121: Missing.

Note: No experimental confirmation available.
Show »
Length:439
Mass (Da):49,100
Checksum:i7ABA00B613731D36
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YEG4H0YEG4_HUMAN
Monocarboxylate transporter 5
SLC16A4
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRV1E9PRV1_HUMAN
Monocarboxylate transporter 5
SLC16A4
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKZ1E9PKZ1_HUMAN
Monocarboxylate transporter 5
SLC16A4
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25I → V in BAF83409 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053655185A → T. Corresponds to variant dbSNP:rs35157487Ensembl.1
Natural variantiVAR_020309264N → H1 PublicationCorresponds to variant dbSNP:rs2271885Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0464561 – 120MLKRE…TMGLL → MGMDDCDSFF in isoform 4. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_0462421 – 34Missing in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04624338 – 73TKTFA…LRFCA → DDCDSFFP in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_04645774 – 121Missing in isoform 5. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_046244176 – 343Missing in isoform 3. 1 PublicationAdd BLAST168
Alternative sequenceiVSP_046458446 – 487GWLYD…KNSLT → EIIPSFQAGYMIIPRHTMAL STSLAYAISSLQFPFFLYHW PKDGKTV in isoform 4. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U59185 mRNA Translation: AAB72035.1
AK290720 mRNA Translation: BAF83409.1
AK295946 mRNA Translation: BAG58729.1
AK298539 mRNA Translation: BAG60739.1
AK313735 mRNA Translation: BAG36476.1
AL355488 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56443.1
CH471122 Genomic DNA Translation: EAW56445.1
CH471122 Genomic DNA Translation: EAW56446.1
BC021664 mRNA Translation: AAH21664.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55621.1 [O15374-4]
CCDS55622.1 [O15374-2]
CCDS55623.1 [O15374-5]
CCDS55624.1 [O15374-3]
CCDS823.1 [O15374-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001188475.1, NM_001201546.1 [O15374-5]
NP_001188476.1, NM_001201547.1 [O15374-2]
NP_001188477.1, NM_001201548.1 [O15374-4]
NP_001188478.1, NM_001201549.1 [O15374-3]
NP_004687.1, NM_004696.2 [O15374-1]
XP_005271374.1, XM_005271317.4 [O15374-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.351306

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000369779; ENSP00000358794; ENSG00000168679 [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679 [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679 [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679 [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679 [O15374-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9122

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9122

UCSC genome browser

More...
UCSCi
uc001dzo.3 human [O15374-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59185 mRNA Translation: AAB72035.1
AK290720 mRNA Translation: BAF83409.1
AK295946 mRNA Translation: BAG58729.1
AK298539 mRNA Translation: BAG60739.1
AK313735 mRNA Translation: BAG36476.1
AL355488 Genomic DNA No translation available.
CH471122 Genomic DNA Translation: EAW56443.1
CH471122 Genomic DNA Translation: EAW56445.1
CH471122 Genomic DNA Translation: EAW56446.1
BC021664 mRNA Translation: AAH21664.1
CCDSiCCDS55621.1 [O15374-4]
CCDS55622.1 [O15374-2]
CCDS55623.1 [O15374-5]
CCDS55624.1 [O15374-3]
CCDS823.1 [O15374-1]
RefSeqiNP_001188475.1, NM_001201546.1 [O15374-5]
NP_001188476.1, NM_001201547.1 [O15374-2]
NP_001188477.1, NM_001201548.1 [O15374-4]
NP_001188478.1, NM_001201549.1 [O15374-3]
NP_004687.1, NM_004696.2 [O15374-1]
XP_005271374.1, XM_005271317.4 [O15374-1]
UniGeneiHs.351306

3D structure databases

ProteinModelPortaliO15374
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114570, 2 interactors
IntActiO15374, 3 interactors
MINTiO15374

Chemistry databases

DrugBankiDB00119 Pyruvic acid

Protein family/group databases

TCDBi2.A.1.13.7 the major facilitator superfamily (mfs)

PTM databases

iPTMnetiO15374
PhosphoSitePlusiO15374

Polymorphism and mutation databases

BioMutaiSLC16A4

Proteomic databases

jPOSTiO15374
MaxQBiO15374
PaxDbiO15374
PeptideAtlasiO15374
PRIDEiO15374
ProteomicsDBi48616

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369779; ENSP00000358794; ENSG00000168679 [O15374-1]
ENST00000369781; ENSP00000358796; ENSG00000168679 [O15374-3]
ENST00000437429; ENSP00000394790; ENSG00000168679 [O15374-4]
ENST00000472422; ENSP00000432495; ENSG00000168679 [O15374-5]
ENST00000541986; ENSP00000446087; ENSG00000168679 [O15374-2]
GeneIDi9122
KEGGihsa:9122
UCSCiuc001dzo.3 human [O15374-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9122
DisGeNETi9122
EuPathDBiHostDB:ENSG00000168679.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC16A4
HGNCiHGNC:10925 SLC16A4
HPAiHPA046986
HPA060163
MIMi603878 gene
neXtProtiNX_O15374
OpenTargetsiENSG00000168679
PharmGKBiPA35816

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMVW Eukaryota
ENOG410ZITK LUCA
GeneTreeiENSGT00940000158411
HOGENOMiHOG000059591
HOVERGENiHBG006385
InParanoidiO15374
KOiK08181
OMAiYTQTYTG
OrthoDBi916876at2759
PhylomeDBiO15374
TreeFamiTF313792

Enzyme and pathway databases

SIGNORiO15374

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC16A4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9122

Protein Ontology

More...
PROi
PR:O15374

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168679 Expressed in 176 organ(s), highest expression level in palpebral conjunctiva
CleanExiHS_SLC16A4
ExpressionAtlasiO15374 baseline and differential
GenevisibleiO15374 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR011701 MFS
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
PfamiView protein in Pfam
PF07690 MFS_1, 1 hit
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS50850 MFS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMOT5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15374
Secondary accession number(s): A8K3V5
, B2R9C9, B4DJ67, B4DPX7, E7EPY8, G3V175, Q5T612, Q8WU09
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: January 16, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again