Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - O15350 (P73_HUMAN)

Entry version 229 (02 Dec 2020)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Add a publicationFeedback
Protein

Tumor protein p73

Gene

TP73

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.3 Publications

Miscellaneous

Maps to a chromosome region frequently mutated in diverse cell lines of human cancer. Appears not to be frequently mutated in human cancers, in contrast to p53/TP53. Hemizygosity is observed in neuroblastoma and oligodendroglioma.
Activated and stabilized by interaction with RANBP9.

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi194ZincBy similarity1
Metal bindingi197ZincBy similarity1
Metal bindingi258ZincBy similarity1
Metal bindingi262ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processApoptosis, Cell cycle, Host-virus interaction, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		O15350

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-139915, Activation of PUMA and translocation to mitochondria
R-HSA-6803204, TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-6803205, TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
R-HSA-6803207, TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-6803211, TP53 Regulates Transcription of Death Receptors and Ligands
R-HSA-6804759, Regulation of TP53 Activity through Association with Co-factors
R-HSA-8939236, RUNX1 regulates transcription of genes involved in differentiation of HSCs

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		O15350

SIGNOR Signaling Network Open Resource

More...SIGNORi		O15350

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor protein p73
Alternative name(s):
p53-like transcription factor
p53-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TP73
Synonyms:P73
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000078900.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:12003, TP73

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601990, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_O15350

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi27T → A: Impaired phosphorylation. 1 Publication1
Mutagenesisi99Y → F: Impaired phosphorylation of isoform beta by ABL1. 1 Publication1
Mutagenesisi487Y → A: Loss of interaction with WWOX. 1 Publication1
Mutagenesisi627K → R: Strongly diminishes sumoylation but does not affect transcriptional activity. 1 Publication1

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

DisGeNET

More...DisGeNETi		7161

MalaCards human disease database

More...MalaCardsi		TP73

Open Targets

More...OpenTargetsi		ENSG00000078900

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		70573, Small cell lung cancer

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36684

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		O15350, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB01593, Zinc
DB14487, Zinc acetate
DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TP73

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001857281 – 636Tumor protein p73Add BLAST636

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27Phosphothreonine; by PLK12 Publications1
Modified residuei28Phosphotyrosine; by SRC and HCK1 Publication1
Modified residuei99Phosphotyrosine; by ABL11 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki627Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); in isoform Alpha1 Publication
Cross-linki627Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform alpha (but not isoform beta) is sumoylated on Lys-627, which potentiates proteasomal degradation but does not affect transcriptional activity. Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function.1 Publication
Higher levels of phosphorylation seen in the brain from patients with Huntington disease.
Polyubiquitinated by RCHY1/PIRH2; leading to its degradation by the proteasome.2 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		O15350

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		O15350

MaxQB - The MaxQuant DataBase

More...MaxQBi		O15350

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		O15350

PeptideAtlas

More...PeptideAtlasi		O15350

PRoteomics IDEntifications database

More...PRIDEi		O15350

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		48597 [O15350-1]
48598 [O15350-10]
48599 [O15350-2]
48600 [O15350-3]
48601 [O15350-4]
48602 [O15350-5]
48603 [O15350-6]
48604 [O15350-8]
48605 [O15350-9]
6877
8551

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		O15350

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		O15350

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Not induced by DNA damage. Isoforms lacking the transactivation domain block gene induction.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000078900, Expressed in right uterine tube and 94 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		O15350, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		O15350, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000078900, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with p53/TP53 and CABLES1. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain.

Interacts with HECW2. Isoform Beta interacts homotypically and with p53/TP53, whereas isoform Alpha does not. Isoform Gamma interacts homotypically and with all p73 isoforms. Isoform Delta interacts with isoform Gamma, isoform Alpha, and homotypically. Isoforms Alpha and Beta interact with HIPK2. Isoform Alpha interacts with RANBP9. Isoform Beta interacts with WWOX.

Interacts (via SAM domain) with FBXO45 (via B30.2/SPRY domain).

Interacts with YAP1 (phosphorylated form).

Interacts with HCK (via SH3 domain); this inhibits TP73 activity and degradation.

9 Publications

(Microbial infection) Interacts with Epstein-Barr virus protein EBNA6; this interaction inhibits TP73-mediated apoptotic pathway.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		113014, 148 interactors

Database of interacting proteins

More...DIPi		DIP-24202N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		O15350

Protein interaction database and analysis system

More...IntActi		O15350, 35 interactors

Molecular INTeraction database

More...MINTi		O15350

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000367545

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		O15350, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1636
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		O15350

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		O15350

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini485 – 551SAMAdd BLAST67

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 46TransactivationBy similarityAdd BLAST46
Regioni131 – 310DNA-bindingSequence analysisAdd BLAST180
Regioni345 – 386OligomerizationSequence analysisAdd BLAST42
Regioni345 – 380Interaction with HIPK21 PublicationAdd BLAST36

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi483 – 487PPxY motif5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 55Asp/Glu-rich (acidic)Add BLAST55
Compositional biasi168 – 171Poly-Pro4
Compositional biasi391 – 394Poly-Gln4
Compositional biasi483 – 486Poly-Pro4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Possesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL1 tyrosine kinase SH3 domain.1 Publication
The PPxY motif mediates interaction with WWOX.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the p53 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QQ48, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183153

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_019621_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		O15350

Identification of Orthologs from Complete Genome Data

More...OMAi		FQHLWSS

Database for complete collections of gene phylogenies

More...PhylomeDBi		O15350

TreeFam database of animal gene trees

More...TreeFami		TF106101

Family and domain databases

Conserved Domains Database

More...CDDi		cd08367, P53, 1 hit
cd09571, SAM_tumor-p73, 1 hit

Database of protein disorder

More...DisProti		DP00319

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.150.50, 1 hit
2.60.40.720, 1 hit
4.10.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008967, p53-like_TF_DNA-bd
IPR012346, p53/RUNT-type_TF_DNA-bd_sf
IPR011615, p53_DNA-bd
IPR036674, p53_tetramer_sf
IPR010991, p53_tetrameristn
IPR002117, p53_tumour_suppressor
IPR001660, SAM
IPR013761, SAM/pointed_sf
IPR032646, Tp73
IPR037612, Tumour-p73_SAM

The PANTHER Classification System

More...PANTHERi		PTHR11447, PTHR11447, 1 hit
PTHR11447:SF21, PTHR11447:SF21, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00870, P53, 1 hit
PF07710, P53_tetramer, 1 hit
PF07647, SAM_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00386, P53SUPPRESSR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00454, SAM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47719, SSF47719, 1 hit
SSF47769, SSF47769, 1 hit
SSF49417, SSF49417, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00348, P53, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform Alpha (identifier: O15350-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQSTATSPD GGTTFEHLWS SLEPDSTYFD LPQSSRGNNE VVGGTDSSMD 
        60         70         80         90        100
VFHLEGMTTS VMAQFNLLSS TMDQMSSRAA SASPYTPEHA ASVPTHSPYA 
       110        120        130        140        150
QPSSTFDTMS PAPVIPSNTD YPGPHHFEVT FQQSSTAKSA TWTYSPLLKK 
       160        170        180        190        200
LYCQIAKTCP IQIKVSTPPP PGTAIRAMPV YKKAEHVTDV VKRCPNHELG 
       210        220        230        240        250
RDFNEGQSAP ASHLIRVEGN NLSQYVDDPV TGRQSVVVPY EPPQVGTEFT 
       260        270        280        290        300
TILYNFMCNS SCVGGMNRRP ILIIITLEMR DGQVLGRRSF EGRICACPGR 
       310        320        330        340        350
DRKADEDHYR EQQALNESSA KNGAASKRAF KQSPPAVPAL GAGVKKRRHG 
       360        370        380        390        400
DEDTYYLQVR GRENFEILMK LKESLELMEL VPQPLVDSYR QQQQLLQRPS 
       410        420        430        440        450
HLQPPSYGPV LSPMNKVHGG MNKLPSVNQL VGQPPPHSSA ATPNLGPVGP 
       460        470        480        490        500
GMLNNHGHAV PANGEMSSSH SAQSMVSGSH CTPPPPYHAD PSLVSFLTGL 
       510        520        530        540        550
GCPNCIEYFT SQGLQSIYHL QNLTIEDLGA LKIPEQYRMT IWRGLQDLKQ 
       560        570        580        590        600
GHDYSTAQQL LRSSNAATIS IGGSGELQRQ RVMEAVHFRV RHTITIPNRG 
       610        620        630 
GPGGGPDEWA DFGFDLPDCK ARKQPIKEEF TEAEIH
Length:636
Mass (Da):69,623
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA467493C5D93EEE0
GO
Isoform Beta (identifier: O15350-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     495-636: SFLTGLGCPN...KEEFTEAEIH → RTWGP

Note: Produced by alternative splicing of isoform Alpha.Curated
Show »
Length:499
Mass (Da):54,322
Checksum:i0FDC0546E29D683E
GO
Isoform Gamma (identifier: O15350-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-476: SHLQPPSYGP...SSSHSAQSMV → PRDAQQPWPR...EHLPPAEPDH
     477-636: Missing.

Note: Produced by alternative splicing of isoform Alpha. The splicing of exon 11 results in a frameshift from the original reading frame.Curated
Show »
Length:476
Mass (Da):53,026
Checksum:i78D99E725DCEFD5F
GO
Isoform Delta (identifier: O15350-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-403: SHLQ → TWGP
     404-636: Missing.

Note: Produced by alternative splicing of isoform Alpha.Curated
Show »
Length:403
Mass (Da):44,517
Checksum:i72F1A3518940D832
GO
Isoform Epsilon (identifier: O15350-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-445: SHLQPPSYGP...PHSSAATPNL → PRDAQQPWPR...TPLPRRPQPR
     446-526: Missing.

Note: Produced by alternative splicing of isoform Alpha. The splicing of exon 11 results in a frameshift from the original reading frame. The splicing of exon 13 reverts the reading frame to the sequence of isoform Alpha.Curated
Show »
Length:555
Mass (Da):61,694
Checksum:i4C821E6FB836EC32
GO
Isoform Zeta (identifier: O15350-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-495: Missing.

Note: Produced by alternative splicing of isoform Alpha.Curated
Show »
Length:540
Mass (Da):59,887
Checksum:iA996F9FEB731ABD1
GO
Isoform dN-Alpha (identifier: O15350-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT

Note: Produced by alternative promoter usage.Curated
Show »
Length:587
Mass (Da):64,422
Checksum:iE8F1CAE88CED4EBC
GO
Isoform dN-Beta (identifier: O15350-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT
     495-636: SFLTGLGCPN...KEEFTEAEIH → RTWGP

Note: Produced by alternative splicing of isoform dN-Alpha.Curated
Show »
Length:450
Mass (Da):49,121
Checksum:iF1950AE8628B3863
GO
Isoform dN-Gamma (identifier: O15350-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT
     400-476: SHLQPPSYGP...SSSHSAQSMV → PRDAQQPWPR...EHLPPAEPDH
     477-636: Missing.

Note: Produced by alternative splicing of isoform dN-Alpha.Curated
Show »
Length:427
Mass (Da):47,824
Checksum:i9D140E5D48BFB56E
GO
Isoform 10 (identifier: O15350-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Show »
Length:565
Mass (Da):62,034
Checksum:i3D989435C093E515
GO
Isoform 11 (identifier: O15350-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVM → MLYVGDPARHLAT
     400-636: Missing.

Show »
Length:350
Mass (Da):38,874
Checksum:i4BA732383EFE92A0
GO
Isoform 12 (identifier: O15350-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-526: SHLQPPSYGP...IYHLQNLTIE → PRDAQQPWPR...PLPRRPQPRQ

Show »
Length:555
Mass (Da):61,694
Checksum:i40CC002014B124C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DFW9A0A0C4DFW9_HUMAN
Cellular tumor antigen p53
TP73 hCG_19088
426Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0450821 – 71Missing in isoform 10. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_0143681 – 62MAQST…TTSVM → MLYVGDPARHLAT in isoform dN-Alpha, isoform dN-Beta, isoform dN-Gamma and isoform 11. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_053809400 – 636Missing in isoform 11. 1 PublicationAdd BLAST237
Alternative sequenceiVSP_053810400 – 526SHLQP…NLTIE → PRDAQQPWPRSASQRRDEQQ PQRPVHGLGVPLHSATPLPR RPQPRQ in isoform 12. CuratedAdd BLAST127
Alternative sequenceiVSP_006546400 – 495Missing in isoform Zeta. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_006540400 – 476SHLQP…AQSMV → PRDAQQPWPRSASQQRRDEQ QPQRPVHGLGVPLHSATPLP RRPQPRQFFNRIGVSKLHRV FHLPRVTEHLPPAEPDH in isoform Gamma and isoform dN-Gamma. 2 PublicationsAdd BLAST77
Alternative sequenceiVSP_006544400 – 445SHLQP…ATPNL → PRDAQQPWPRSASQQRRDEQ QPQRPVHGLGVPLHSATPLP RRPQPR in isoform Epsilon. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_006542400 – 403SHLQ → TWGP in isoform Delta. 1 Publication4
Alternative sequenceiVSP_006543404 – 636Missing in isoform Delta. 1 PublicationAdd BLAST233
Alternative sequenceiVSP_006545446 – 526Missing in isoform Epsilon. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_006541477 – 636Missing in isoform Gamma and isoform dN-Gamma. 2 PublicationsAdd BLAST160
Alternative sequenceiVSP_006539495 – 636SFLTG…EAEIH → RTWGP in isoform Beta and isoform dN-Beta. 3 PublicationsAdd BLAST142

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y11416 mRNA Translation: CAA72220.1
Y11416 mRNA Translation: CAA72221.1
Y11416 mRNA Translation: CAA72219.1
AF079094 AF079093 Genomic DNA Translation: AAD39696.1
AF077628 AF077627 Genomic DNA Translation: AAC61887.1
AY040827 mRNA Translation: AAK81884.1
AY040828 mRNA Translation: AAK81885.1
AY040829 mRNA Translation: AAK81886.1
AB055065 mRNA Translation: BAB87244.1
AB055066 mRNA Translation: BAB87245.1
AK302118 mRNA Translation: BAH13630.1
AK304177 mRNA Translation: BAH14127.1
AK304784 mRNA Translation: BAH14257.1
AL136528 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71464.1
BC117251 mRNA Translation: AAI17252.1
BC117253 mRNA Translation: AAI17254.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44049.1 [O15350-8]
CCDS44050.1 [O15350-9]
CCDS49.1 [O15350-1]
CCDS55566.1 [O15350-2]
CCDS55567.1 [O15350-13]
CCDS55568.1 [O15350-6]
CCDS55569.1 [O15350-11]
CCDS59965.1 [O15350-4]

NCBI Reference Sequences

More...RefSeqi		NP_001119712.1, NM_001126240.2 [O15350-8]
NP_001119713.1, NM_001126241.2 [O15350-9]
NP_001119714.1, NM_001126242.2
NP_001191113.1, NM_001204184.1 [O15350-2]
NP_001191114.1, NM_001204185.1
NP_001191115.1, NM_001204186.1 [O15350-4]
NP_001191116.1, NM_001204187.1 [O15350-13]
NP_001191117.1, NM_001204188.1 [O15350-6]
NP_001191118.1, NM_001204189.1
NP_001191119.1, NM_001204190.1
NP_001191120.1, NM_001204191.1
NP_001191121.1, NM_001204192.1 [O15350-11]
NP_005418.1, NM_005427.3 [O15350-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000346387; ENSP00000340740; ENSG00000078900 [O15350-6]
ENST00000354437; ENSP00000346423; ENSG00000078900 [O15350-2]
ENST00000357733; ENSP00000350366; ENSG00000078900 [O15350-13]
ENST00000378285; ENSP00000367534; ENSG00000078900 [O15350-9]
ENST00000378288; ENSP00000367537; ENSG00000078900 [O15350-8]
ENST00000378290; ENSP00000367539; ENSG00000078900 [O15350-11]
ENST00000378295; ENSP00000367545; ENSG00000078900 [O15350-1]
ENST00000603362; ENSP00000474626; ENSG00000078900 [O15350-13]
ENST00000604074; ENSP00000475143; ENSG00000078900 [O15350-4]
ENST00000604479; ENSP00000474322; ENSG00000078900 [O15350-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7161

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7161

UCSC genome browser

More...UCSCi		uc001akp.4, human [O15350-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y11416 mRNA Translation: CAA72220.1
Y11416 mRNA Translation: CAA72221.1
Y11416 mRNA Translation: CAA72219.1
AF079094 AF079093 Genomic DNA Translation: AAD39696.1
AF077628 AF077627 Genomic DNA Translation: AAC61887.1
AY040827 mRNA Translation: AAK81884.1
AY040828 mRNA Translation: AAK81885.1
AY040829 mRNA Translation: AAK81886.1
AB055065 mRNA Translation: BAB87244.1
AB055066 mRNA Translation: BAB87245.1
AK302118 mRNA Translation: BAH13630.1
AK304177 mRNA Translation: BAH14127.1
AK304784 mRNA Translation: BAH14257.1
AL136528 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71464.1
BC117251 mRNA Translation: AAI17252.1
BC117253 mRNA Translation: AAI17254.1
CCDSiCCDS44049.1 [O15350-8]
CCDS44050.1 [O15350-9]
CCDS49.1 [O15350-1]
CCDS55566.1 [O15350-2]
CCDS55567.1 [O15350-13]
CCDS55568.1 [O15350-6]
CCDS55569.1 [O15350-11]
CCDS59965.1 [O15350-4]
RefSeqiNP_001119712.1, NM_001126240.2 [O15350-8]
NP_001119713.1, NM_001126241.2 [O15350-9]
NP_001119714.1, NM_001126242.2
NP_001191113.1, NM_001204184.1 [O15350-2]
NP_001191114.1, NM_001204185.1
NP_001191115.1, NM_001204186.1 [O15350-4]
NP_001191116.1, NM_001204187.1 [O15350-13]
NP_001191117.1, NM_001204188.1 [O15350-6]
NP_001191118.1, NM_001204189.1
NP_001191119.1, NM_001204190.1
NP_001191120.1, NM_001204191.1
NP_001191121.1, NM_001204192.1 [O15350-11]
NP_005418.1, NM_005427.3 [O15350-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1COKNMR-A487-554[»]
1DXSX-ray2.54A487-564[»]
2KBYNMR-A/B/C/D351-398[»]
2MPSNMR-B10-25[»]
2NB1NMR-B/D351-398[»]
2WQIX-ray1.70A/B/C/D351-399[»]
2WQJX-ray2.001/2/A/B/C/D/E/F/G/H/I/J/K/L/M/N/O/P/Q/R/S/T/U/V/W/X/Y/Z351-383[»]
2WTTX-ray2.30A/B/C/D/E/F/G/H/I/J/K/L/M/N/O/P351-399[»]
2XWCX-ray1.82A112-311[»]
3VD0X-ray2.95A/B/C/D/I/J/K/L115-312[»]
3VD1X-ray2.95A/B/C/D/I/J/K/L115-312[»]
3VD2X-ray4.00A/B/C/D/I/J115-312[»]
4A63X-ray2.27A/C/E/G/I/K112-311[»]
4G82X-ray3.10A/B115-312[»]
4G83X-ray4.00A/B115-312[»]
4GUOX-ray3.19A/B/C/D/I/J/K/L115-312[»]
4GUQX-ray3.70A/B115-312[»]
5HOBX-ray1.22A/B/C/D/E/F/G/H351-398[»]
5HOCX-ray1.36A/B351-398[»]
5KBDX-ray2.80A/B115-312[»]
6FGSNMR-A10-31[»]
6IJQNMR-A10-25[»]
SMRiO15350
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113014, 148 interactors
DIPiDIP-24202N
ELMiO15350
IntActiO15350, 35 interactors
MINTiO15350
STRINGi9606.ENSP00000367545

Chemistry databases

DrugBankiDB01593, Zinc
DB14487, Zinc acetate
DB14533, Zinc chloride
DB14548, Zinc sulfate, unspecified form

PTM databases

iPTMnetiO15350
PhosphoSitePlusiO15350

Polymorphism and mutation databases

BioMutaiTP73

Proteomic databases

jPOSTiO15350
MassIVEiO15350
MaxQBiO15350
PaxDbiO15350
PeptideAtlasiO15350
PRIDEiO15350
ProteomicsDBi48597 [O15350-1]
48598 [O15350-10]
48599 [O15350-2]
48600 [O15350-3]
48601 [O15350-4]
48602 [O15350-5]
48603 [O15350-6]
48604 [O15350-8]
48605 [O15350-9]
6877
8551

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3467, 1100 antibodies

The DNASU plasmid repository

More...DNASUi		7161

Genome annotation databases

EnsembliENST00000346387; ENSP00000340740; ENSG00000078900 [O15350-6]
ENST00000354437; ENSP00000346423; ENSG00000078900 [O15350-2]
ENST00000357733; ENSP00000350366; ENSG00000078900 [O15350-13]
ENST00000378285; ENSP00000367534; ENSG00000078900 [O15350-9]
ENST00000378288; ENSP00000367537; ENSG00000078900 [O15350-8]
ENST00000378290; ENSP00000367539; ENSG00000078900 [O15350-11]
ENST00000378295; ENSP00000367545; ENSG00000078900 [O15350-1]
ENST00000603362; ENSP00000474626; ENSG00000078900 [O15350-13]
ENST00000604074; ENSP00000475143; ENSG00000078900 [O15350-4]
ENST00000604479; ENSP00000474322; ENSG00000078900 [O15350-6]
GeneIDi7161
KEGGihsa:7161
UCSCiuc001akp.4, human [O15350-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7161
DisGeNETi7161
EuPathDBiHostDB:ENSG00000078900.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		TP73
HGNCiHGNC:12003, TP73
HPAiENSG00000078900, Tissue enhanced (brain)
MalaCardsiTP73
MIMi601990, gene
neXtProtiNX_O15350
OpenTargetsiENSG00000078900
Orphaneti70573, Small cell lung cancer
PharmGKBiPA36684

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QQ48, Eukaryota
GeneTreeiENSGT00950000183153
HOGENOMiCLU_019621_1_0_1
InParanoidiO15350
OMAiFQHLWSS
PhylomeDBiO15350
TreeFamiTF106101

Enzyme and pathway databases

PathwayCommonsiO15350
ReactomeiR-HSA-139915, Activation of PUMA and translocation to mitochondria
R-HSA-6803204, TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-6803205, TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
R-HSA-6803207, TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-6803211, TP53 Regulates Transcription of Death Receptors and Ligands
R-HSA-6804759, Regulation of TP53 Activity through Association with Co-factors
R-HSA-8939236, RUNX1 regulates transcription of genes involved in differentiation of HSCs
SignaLinkiO15350
SIGNORiO15350

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		7161, 10 hits in 870 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TP73, human
EvolutionaryTraceiO15350

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		P73

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7161
PharosiO15350, Tbio

Protein Ontology

More...PROi		PR:O15350
RNActiO15350, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000078900, Expressed in right uterine tube and 94 other tissues
ExpressionAtlasiO15350, baseline and differential
GenevisibleiO15350, HS

Family and domain databases

CDDicd08367, P53, 1 hit
cd09571, SAM_tumor-p73, 1 hit
DisProtiDP00319
Gene3Di1.10.150.50, 1 hit
2.60.40.720, 1 hit
4.10.170.10, 1 hit
InterProiView protein in InterPro
IPR008967, p53-like_TF_DNA-bd
IPR012346, p53/RUNT-type_TF_DNA-bd_sf
IPR011615, p53_DNA-bd
IPR036674, p53_tetramer_sf
IPR010991, p53_tetrameristn
IPR002117, p53_tumour_suppressor
IPR001660, SAM
IPR013761, SAM/pointed_sf
IPR032646, Tp73
IPR037612, Tumour-p73_SAM
PANTHERiPTHR11447, PTHR11447, 1 hit
PTHR11447:SF21, PTHR11447:SF21, 1 hit
PfamiView protein in Pfam
PF00870, P53, 1 hit
PF07710, P53_tetramer, 1 hit
PF07647, SAM_2, 1 hit
PRINTSiPR00386, P53SUPPRESSR
SMARTiView protein in SMART
SM00454, SAM, 1 hit
SUPFAMiSSF47719, SSF47719, 1 hit
SSF47769, SSF47769, 1 hit
SSF49417, SSF49417, 1 hit
PROSITEiView protein in PROSITE
PS00348, P53, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP73_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15350
Secondary accession number(s): B7Z7J4
, B7Z8Z1, B7Z9C1, C9J521, O15351, Q17RN8, Q5TBV5, Q5TBV6, Q8NHW9, Q8TDY5, Q8TDY6, Q9NTK8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 1, 1998
Last modified: December 2, 2020
This is version 229 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again