Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA repair protein RAD51 homolog 2

Gene

RAD51B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi108 – 115ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: UniProtKB
  • double-stranded DNA binding Source: UniProtKB
  • single-stranded DNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA recombination, DNA repair
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-983231 Factors involved in megakaryocyte development and platelet production
SIGNORiO15315

Names & Taxonomyi

Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 2
Short name:
R51H2
Alternative name(s):
RAD51 homolog B
Short name:
Rad51B
RAD51-like protein 1
Gene namesi
Name:RAD51B
Synonyms:RAD51L1, REC2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000182185.18
HGNCiHGNC:9822 RAD51B
MIMi602948 gene
neXtProtiNX_O15315

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving RAD51B is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with HMGA1.1 Publication
A chromosomal aberration involving RAD51B is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with HMGA2.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi326P → L: Abolishes interaction with BCR-ABL SH3 domain. 1 Publication1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei252 – 253Breakpoint for translocation to form HMGA2-RAD51B2

Organism-specific databases

DisGeNETi5890
MIMi150699 phenotype
OpenTargetsiENSG00000182185
PharmGKBiPA34178

Polymorphism and mutation databases

BioMutaiRAD51B

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001229391 – 384DNA repair protein RAD51 homolog 2Add BLAST384

Post-translational modificationi

Phosphorylated on tyrosine residues by BCR-ABL.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiO15315
PeptideAtlasiO15315
PRIDEiO15315
ProteomicsDBi48575
48576 [O15315-1]
48577 [O15315-2]
48578 [O15315-4]
48579 [O15315-5]
TopDownProteomicsiO15315-2 [O15315-2]

PTM databases

iPTMnetiO15315
PhosphoSitePlusiO15315

Expressioni

Tissue specificityi

Expressed in a wide range of tissues.

Gene expression databases

BgeeiENSG00000182185 Expressed in 149 organ(s), highest expression level in corpus callosum
ExpressionAtlasiO15315 baseline and differential
GenevisibleiO15315 HS

Organism-specific databases

HPAiCAB016191
HPA051869

Interactioni

Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. The BCDX2 subcomplex RAD51B:RAD51C interacts with RAD51. Interacts with SWSAP1; involved in homologous recombination repair.8 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi111827, 12 interactors
CORUMiO15315
DIPiDIP-41246N
IntActiO15315, 12 interactors
MINTiO15315
STRINGi9606.ENSP00000419471

Structurei

3D structure databases

ProteinModelPortaliO15315
SMRiO15315
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 75Interaction with RAD51CAdd BLAST75

Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.Curated

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
COG0468 LUCA
GeneTreeiENSGT00860000133731
HOVERGENiHBG061476
InParanoidiO15315
KOiK10869
OMAiMQTAYEI
PhylomeDBiO15315
TreeFamiTF101219

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR030548 RAD51B
IPR020588 RecA_ATP-bd
PANTHERiPTHR22942:SF15 PTHR22942:SF15, 1 hit
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15315-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSKKLKRVG LSQELCDRLS RHQILTCQDF LCLSPLELMK VTGLSYRGVH
60 70 80 90 100
ELLCMVSRAC APKMQTAYGI KAQRSADFSP AFLSTTLSAL DEALHGGVAC
110 120 130 140 150
GSLTEITGPP GCGKTQFCIM MSILATLPTN MGGLEGAVVY IDTESAFSAE
160 170 180 190 200
RLVEIAESRF PRYFNTEEKL LLTSSKVHLY RELTCDEVLQ RIESLEEEII
210 220 230 240 250
SKGIKLVILD SVASVVRKEF DAQLQGNLKE RNKFLAREAS SLKYLAEEFS
260 270 280 290 300
IPVILTNQIT THLSGALASQ ADLVSPADDL SLSEGTSGSS CVIAALGNTW
310 320 330 340 350
SHSVNTRLIL QYLDSERRQI LIAKSPLAPF TSFVYTIKEE GLVLQETTFC
360 370 380
SVTQAELNWA PEILPPQPPE QLGLQMCHHT QLIF
Length:384
Mass (Da):42,196
Last modified:November 7, 2003 - v2
Checksum:iDB0B9AE82F44A52B
GO
Isoform 2 (identifier: O15315-1) [UniParc]FASTAAdd to basket
Also known as: RAD51L1a

The sequence of this isoform differs from the canonical sequence as follows:
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → AYGNS

Show »
Length:350
Mass (Da):38,257
Checksum:iCEA992DDC394F3B0
GO
Isoform 3 (identifier: O15315-2) [UniParc]FASTAAdd to basket
Also known as: RAD51L1b

The sequence of this isoform differs from the canonical sequence as follows:
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP

Show »
Length:350
Mass (Da):38,304
Checksum:iCC7EE1B04634F3B0
GO
Isoform 4 (identifier: O15315-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-384: TTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → FWHICISGFSIQNRLKENES

Note: No experimental confirmation available.
Show »
Length:366
Mass (Da):40,284
Checksum:i790D20F0E8EB791A
GO
Isoform 5 (identifier: O15315-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP

Note: No experimental confirmation available.
Show »
Length:231
Mass (Da):25,527
Checksum:i2EAE6E210C8E74B6
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS18A0A0A0MS18_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
279Annotation score:
C9JYJ0C9JYJ0_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
425Annotation score:
C9J5S9C9J5S9_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
133Annotation score:
F8WAY6F8WAY6_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
108Annotation score:
G3V4W9G3V4W9_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
75Annotation score:
H0YJI5H0YJI5_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
35Annotation score:

Sequence cautioni

The sequence CAD62357 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAD66573 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti281S → P in AAN60542 (PubMed:15489334).Curated1
Sequence conflicti281S → P in AAN60543 (PubMed:15489334).Curated1
Sequence conflicti281S → P in AAN60544 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0252439V → M1 PublicationCorresponds to variant dbSNP:rs34583846Ensembl.1
Natural variantiVAR_02524482F → C1 PublicationCorresponds to variant dbSNP:rs35282642Ensembl.1
Natural variantiVAR_025245172L → W1 PublicationCorresponds to variant dbSNP:rs34094401Ensembl.1
Natural variantiVAR_025246180Y → C1 PublicationCorresponds to variant dbSNP:rs28910275Ensembl.1
Natural variantiVAR_035437207V → L. Corresponds to variant dbSNP:rs28908168Ensembl.1
Natural variantiVAR_025247243K → R1 PublicationCorresponds to variant dbSNP:rs34594234Ensembl.1
Natural variantiVAR_025248250S → A1 PublicationCorresponds to variant dbSNP:rs33929366Ensembl.1
Natural variantiVAR_051730365P → R. Corresponds to variant dbSNP:rs28908468EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0088171 – 119Missing in isoform 5. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_008819346 – 384ETTFC…TQLIF → AYGNS in isoform 2. 3 PublicationsAdd BLAST39
Alternative sequenceiVSP_008818346 – 384ETTFC…TQLIF → GQEKP in isoform 3 and isoform 5. 2 PublicationsAdd BLAST39
Alternative sequenceiVSP_008820347 – 384TTFCS…TQLIF → FWHICISGFSIQNRLKENES in isoform 4. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U92074 mRNA Translation: AAB63358.1
U84138 mRNA Translation: AAC39723.1
Y15571 mRNA Translation: CAA75680.1
BX161515 mRNA Translation: CAD61950.1
BX248061 mRNA Translation: CAD62357.1 Different initiation.
BX248766 mRNA Translation: CAD66573.1 Different initiation.
DQ160197 Genomic DNA Translation: AAZ85144.1
AC004518 Genomic DNA Translation: AAC32426.1
AC004518 Genomic DNA Translation: AAC32425.1
CR536560 mRNA Translation: CAG38797.1
CH471061 Genomic DNA Translation: EAW80957.1
BC030219 mRNA Translation: AAH30219.1
AY138857 mRNA Translation: AAN60542.1
AY138858 mRNA Translation: AAN60543.1
AY138859 mRNA Translation: AAN60544.1
CCDSiCCDS9789.1 [O15315-3]
CCDS9790.1 [O15315-2]
RefSeqiNP_001308746.1, NM_001321817.1 [O15315-5]
NP_002868.1, NM_002877.5 [O15315-1]
NP_598193.2, NM_133509.3 [O15315-3]
NP_598194.1, NM_133510.3 [O15315-2]
UniGeneiHs.172587

Genome annotation databases

EnsembliENST00000471583; ENSP00000418859; ENSG00000182185 [O15315-2]
ENST00000487270; ENSP00000419471; ENSG00000182185 [O15315-3]
ENST00000488612; ENSP00000420061; ENSG00000182185 [O15315-4]
GeneIDi5890
KEGGihsa:5890
UCSCiuc001xkd.4 human [O15315-3]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U92074 mRNA Translation: AAB63358.1
U84138 mRNA Translation: AAC39723.1
Y15571 mRNA Translation: CAA75680.1
BX161515 mRNA Translation: CAD61950.1
BX248061 mRNA Translation: CAD62357.1 Different initiation.
BX248766 mRNA Translation: CAD66573.1 Different initiation.
DQ160197 Genomic DNA Translation: AAZ85144.1
AC004518 Genomic DNA Translation: AAC32426.1
AC004518 Genomic DNA Translation: AAC32425.1
CR536560 mRNA Translation: CAG38797.1
CH471061 Genomic DNA Translation: EAW80957.1
BC030219 mRNA Translation: AAH30219.1
AY138857 mRNA Translation: AAN60542.1
AY138858 mRNA Translation: AAN60543.1
AY138859 mRNA Translation: AAN60544.1
CCDSiCCDS9789.1 [O15315-3]
CCDS9790.1 [O15315-2]
RefSeqiNP_001308746.1, NM_001321817.1 [O15315-5]
NP_002868.1, NM_002877.5 [O15315-1]
NP_598193.2, NM_133509.3 [O15315-3]
NP_598194.1, NM_133510.3 [O15315-2]
UniGeneiHs.172587

3D structure databases

ProteinModelPortaliO15315
SMRiO15315
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111827, 12 interactors
CORUMiO15315
DIPiDIP-41246N
IntActiO15315, 12 interactors
MINTiO15315
STRINGi9606.ENSP00000419471

PTM databases

iPTMnetiO15315
PhosphoSitePlusiO15315

Polymorphism and mutation databases

BioMutaiRAD51B

Proteomic databases

PaxDbiO15315
PeptideAtlasiO15315
PRIDEiO15315
ProteomicsDBi48575
48576 [O15315-1]
48577 [O15315-2]
48578 [O15315-4]
48579 [O15315-5]
TopDownProteomicsiO15315-2 [O15315-2]

Protocols and materials databases

DNASUi5890
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000471583; ENSP00000418859; ENSG00000182185 [O15315-2]
ENST00000487270; ENSP00000419471; ENSG00000182185 [O15315-3]
ENST00000488612; ENSP00000420061; ENSG00000182185 [O15315-4]
GeneIDi5890
KEGGihsa:5890
UCSCiuc001xkd.4 human [O15315-3]

Organism-specific databases

CTDi5890
DisGeNETi5890
EuPathDBiHostDB:ENSG00000182185.18
GeneCardsiRAD51B
H-InvDBiHIX0022466
HGNCiHGNC:9822 RAD51B
HPAiCAB016191
HPA051869
MIMi150699 phenotype
602948 gene
neXtProtiNX_O15315
OpenTargetsiENSG00000182185
PharmGKBiPA34178
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
COG0468 LUCA
GeneTreeiENSGT00860000133731
HOVERGENiHBG061476
InParanoidiO15315
KOiK10869
OMAiMQTAYEI
PhylomeDBiO15315
TreeFamiTF101219

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-983231 Factors involved in megakaryocyte development and platelet production
SIGNORiO15315

Miscellaneous databases

ChiTaRSiRAD51B human
GeneWikiiRAD51L1
GenomeRNAii5890
PROiPR:O15315
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182185 Expressed in 149 organ(s), highest expression level in corpus callosum
ExpressionAtlasiO15315 baseline and differential
GenevisibleiO15315 HS

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR030548 RAD51B
IPR020588 RecA_ATP-bd
PANTHERiPTHR22942:SF15 PTHR22942:SF15, 1 hit
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRA51B_HUMAN
AccessioniPrimary (citable) accession number: O15315
Secondary accession number(s): O60914
, O75210, Q3Y4F8, Q6FHX8, Q86SY3, Q86SY4, Q86TR0, Q86U92, Q86U93, Q86U94, Q8N6H4, Q9UPL5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: November 7, 2003
Last modified: November 7, 2018
This is version 164 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again