Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (13 Feb 2019)
Sequence version 2 (07 Nov 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

DNA repair protein RAD51 homolog 2

Gene

RAD51B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway.6 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi108 – 115ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: UniProtKB
  • double-stranded DNA binding Source: UniProtKB
  • single-stranded DNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA recombination, DNA repair
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-983231 Factors involved in megakaryocyte development and platelet production

SIGNOR Signaling Network Open Resource

More...
SIGNORi
O15315

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA repair protein RAD51 homolog 2
Short name:
R51H2
Alternative name(s):
RAD51 homolog B
Short name:
Rad51B
RAD51-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAD51B
Synonyms:RAD51L1, REC2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182185.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9822 RAD51B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602948 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15315

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving RAD51B is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with HMGA1.1 Publication
A chromosomal aberration involving RAD51B is found in uterine leiomyoma. Translocation t(12;14)(q15;q23-24) with HMGA2.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi326P → L: Abolishes interaction with BCR-ABL SH3 domain. 1 Publication1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei252 – 253Breakpoint for translocation to form HMGA2-RAD51B2

Organism-specific databases

DisGeNET

More...
DisGeNETi
5890
MIMi150699 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000182185

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34178

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAD51B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001229391 – 384DNA repair protein RAD51 homolog 2Add BLAST384

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues by BCR-ABL.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
O15315

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15315

PeptideAtlas

More...
PeptideAtlasi
O15315

PRoteomics IDEntifications database

More...
PRIDEi
O15315

ProteomicsDB human proteome resource

More...
ProteomicsDBi
48575
48576 [O15315-1]
48577 [O15315-2]
48578 [O15315-4]
48579 [O15315-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
O15315-2 [O15315-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15315

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15315

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a wide range of tissues.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182185 Expressed in 149 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15315 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15315 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB016191
HPA051869

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2; the complex has a ring-like structure arranged into a flat disc around a central channel. The BCDX2 subcomplex RAD51B:RAD51C interacts with RAD51. Interacts with SWSAP1; involved in homologous recombination repair.8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111827, 13 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
O15315

Database of interacting proteins

More...
DIPi
DIP-41246N

Protein interaction database and analysis system

More...
IntActi
O15315, 11 interactors

Molecular INTeraction database

More...
MINTi
O15315

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000419471

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
O15315

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15315

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 75Interaction with RAD51CAdd BLAST75

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RecA family. RAD51 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1433 Eukaryota
COG0468 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160169

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG061476

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15315

KEGG Orthology (KO)

More...
KOi
K10869

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQTAYEI

Database of Orthologous Groups

More...
OrthoDBi
1345899at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15315

TreeFam database of animal gene trees

More...
TreeFami
TF101219

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01123 Rad51_DMC1_radA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR030548 RAD51B
IPR020588 RecA_ATP-bd

The PANTHER Classification System

More...
PANTHERi
PTHR22942:SF15 PTHR22942:SF15, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08423 Rad51, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005856 Rad51, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50162 RECA_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: O15315-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSKKLKRVG LSQELCDRLS RHQILTCQDF LCLSPLELMK VTGLSYRGVH
60 70 80 90 100
ELLCMVSRAC APKMQTAYGI KAQRSADFSP AFLSTTLSAL DEALHGGVAC
110 120 130 140 150
GSLTEITGPP GCGKTQFCIM MSILATLPTN MGGLEGAVVY IDTESAFSAE
160 170 180 190 200
RLVEIAESRF PRYFNTEEKL LLTSSKVHLY RELTCDEVLQ RIESLEEEII
210 220 230 240 250
SKGIKLVILD SVASVVRKEF DAQLQGNLKE RNKFLAREAS SLKYLAEEFS
260 270 280 290 300
IPVILTNQIT THLSGALASQ ADLVSPADDL SLSEGTSGSS CVIAALGNTW
310 320 330 340 350
SHSVNTRLIL QYLDSERRQI LIAKSPLAPF TSFVYTIKEE GLVLQETTFC
360 370 380
SVTQAELNWA PEILPPQPPE QLGLQMCHHT QLIF
Length:384
Mass (Da):42,196
Last modified:November 7, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB0B9AE82F44A52B
GO
Isoform 2 (identifier: O15315-1) [UniParc]FASTAAdd to basket
Also known as: RAD51L1a

The sequence of this isoform differs from the canonical sequence as follows:
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → AYGNS

Show »
Length:350
Mass (Da):38,257
Checksum:iCEA992DDC394F3B0
GO
Isoform 3 (identifier: O15315-2) [UniParc]FASTAAdd to basket
Also known as: RAD51L1b

The sequence of this isoform differs from the canonical sequence as follows:
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP

Show »
Length:350
Mass (Da):38,304
Checksum:iCC7EE1B04634F3B0
GO
Isoform 4 (identifier: O15315-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-384: TTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → FWHICISGFSIQNRLKENES

Note: No experimental confirmation available.
Show »
Length:366
Mass (Da):40,284
Checksum:i790D20F0E8EB791A
GO
Isoform 5 (identifier: O15315-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     346-384: ETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF → GQEKP

Note: No experimental confirmation available.
Show »
Length:231
Mass (Da):25,527
Checksum:i2EAE6E210C8E74B6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS18A0A0A0MS18_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
279Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JYJ0C9JYJ0_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
425Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5S9C9J5S9_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAY6F8WAY6_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4W9G3V4W9_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJI5H0YJI5_HUMAN
DNA repair protein RAD51 homolog 2
RAD51B
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD62357 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAD66573 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti281S → P in AAN60542 (PubMed:15489334).Curated1
Sequence conflicti281S → P in AAN60543 (PubMed:15489334).Curated1
Sequence conflicti281S → P in AAN60544 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0252439V → M1 PublicationCorresponds to variant dbSNP:rs34583846Ensembl.1
Natural variantiVAR_02524482F → C1 PublicationCorresponds to variant dbSNP:rs35282642Ensembl.1
Natural variantiVAR_025245172L → W1 PublicationCorresponds to variant dbSNP:rs34094401Ensembl.1
Natural variantiVAR_025246180Y → C1 PublicationCorresponds to variant dbSNP:rs28910275Ensembl.1
Natural variantiVAR_035437207V → L. Corresponds to variant dbSNP:rs28908168Ensembl.1
Natural variantiVAR_025247243K → R1 PublicationCorresponds to variant dbSNP:rs34594234Ensembl.1
Natural variantiVAR_025248250S → A1 PublicationCorresponds to variant dbSNP:rs33929366Ensembl.1
Natural variantiVAR_051730365P → R. Corresponds to variant dbSNP:rs28908468EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0088171 – 119Missing in isoform 5. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_008819346 – 384ETTFC…TQLIF → AYGNS in isoform 2. 3 PublicationsAdd BLAST39
Alternative sequenceiVSP_008818346 – 384ETTFC…TQLIF → GQEKP in isoform 3 and isoform 5. 2 PublicationsAdd BLAST39
Alternative sequenceiVSP_008820347 – 384TTFCS…TQLIF → FWHICISGFSIQNRLKENES in isoform 4. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U92074 mRNA Translation: AAB63358.1
U84138 mRNA Translation: AAC39723.1
Y15571 mRNA Translation: CAA75680.1
BX161515 mRNA Translation: CAD61950.1
BX248061 mRNA Translation: CAD62357.1 Different initiation.
BX248766 mRNA Translation: CAD66573.1 Different initiation.
DQ160197 Genomic DNA Translation: AAZ85144.1
AC004518 Genomic DNA Translation: AAC32426.1
AC004518 Genomic DNA Translation: AAC32425.1
CR536560 mRNA Translation: CAG38797.1
CH471061 Genomic DNA Translation: EAW80957.1
BC030219 mRNA Translation: AAH30219.1
AY138857 mRNA Translation: AAN60542.1
AY138858 mRNA Translation: AAN60543.1
AY138859 mRNA Translation: AAN60544.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9789.1 [O15315-3]
CCDS9790.1 [O15315-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001308746.1, NM_001321817.1 [O15315-5]
NP_002868.1, NM_002877.5 [O15315-1]
NP_598193.2, NM_133509.3 [O15315-3]
NP_598194.1, NM_133510.3 [O15315-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.172587

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000471583; ENSP00000418859; ENSG00000182185 [O15315-2]
ENST00000487270; ENSP00000419471; ENSG00000182185 [O15315-3]
ENST00000488612; ENSP00000420061; ENSG00000182185 [O15315-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5890

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5890

UCSC genome browser

More...
UCSCi
uc001xkd.4 human [O15315-3]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U92074 mRNA Translation: AAB63358.1
U84138 mRNA Translation: AAC39723.1
Y15571 mRNA Translation: CAA75680.1
BX161515 mRNA Translation: CAD61950.1
BX248061 mRNA Translation: CAD62357.1 Different initiation.
BX248766 mRNA Translation: CAD66573.1 Different initiation.
DQ160197 Genomic DNA Translation: AAZ85144.1
AC004518 Genomic DNA Translation: AAC32426.1
AC004518 Genomic DNA Translation: AAC32425.1
CR536560 mRNA Translation: CAG38797.1
CH471061 Genomic DNA Translation: EAW80957.1
BC030219 mRNA Translation: AAH30219.1
AY138857 mRNA Translation: AAN60542.1
AY138858 mRNA Translation: AAN60543.1
AY138859 mRNA Translation: AAN60544.1
CCDSiCCDS9789.1 [O15315-3]
CCDS9790.1 [O15315-2]
RefSeqiNP_001308746.1, NM_001321817.1 [O15315-5]
NP_002868.1, NM_002877.5 [O15315-1]
NP_598193.2, NM_133509.3 [O15315-3]
NP_598194.1, NM_133510.3 [O15315-2]
UniGeneiHs.172587

3D structure databases

ProteinModelPortaliO15315
SMRiO15315
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111827, 13 interactors
CORUMiO15315
DIPiDIP-41246N
IntActiO15315, 11 interactors
MINTiO15315
STRINGi9606.ENSP00000419471

PTM databases

iPTMnetiO15315
PhosphoSitePlusiO15315

Polymorphism and mutation databases

BioMutaiRAD51B

Proteomic databases

jPOSTiO15315
PaxDbiO15315
PeptideAtlasiO15315
PRIDEiO15315
ProteomicsDBi48575
48576 [O15315-1]
48577 [O15315-2]
48578 [O15315-4]
48579 [O15315-5]
TopDownProteomicsiO15315-2 [O15315-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5890
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000471583; ENSP00000418859; ENSG00000182185 [O15315-2]
ENST00000487270; ENSP00000419471; ENSG00000182185 [O15315-3]
ENST00000488612; ENSP00000420061; ENSG00000182185 [O15315-4]
GeneIDi5890
KEGGihsa:5890
UCSCiuc001xkd.4 human [O15315-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5890
DisGeNETi5890
EuPathDBiHostDB:ENSG00000182185.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAD51B

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0022466
HGNCiHGNC:9822 RAD51B
HPAiCAB016191
HPA051869
MIMi150699 phenotype
602948 gene
neXtProtiNX_O15315
OpenTargetsiENSG00000182185
PharmGKBiPA34178

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1433 Eukaryota
COG0468 LUCA
GeneTreeiENSGT00940000160169
HOVERGENiHBG061476
InParanoidiO15315
KOiK10869
OMAiMQTAYEI
OrthoDBi1345899at2759
PhylomeDBiO15315
TreeFamiTF101219

Enzyme and pathway databases

ReactomeiR-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-983231 Factors involved in megakaryocyte development and platelet production
SIGNORiO15315

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RAD51B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAD51L1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5890

Protein Ontology

More...
PROi
PR:O15315

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182185 Expressed in 149 organ(s), highest expression level in corpus callosum
ExpressionAtlasiO15315 baseline and differential
GenevisibleiO15315 HS

Family and domain databases

CDDicd01123 Rad51_DMC1_radA, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR013632 DNA_recomb/repair_Rad51_C
IPR016467 DNA_recomb/repair_RecA-like
IPR027417 P-loop_NTPase
IPR033925 Rad51_DMC1_RadA
IPR030548 RAD51B
IPR020588 RecA_ATP-bd
PANTHERiPTHR22942:SF15 PTHR22942:SF15, 1 hit
PfamiView protein in Pfam
PF08423 Rad51, 1 hit
PIRSFiPIRSF005856 Rad51, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50162 RECA_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRA51B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15315
Secondary accession number(s): O60914
, O75210, Q3Y4F8, Q6FHX8, Q86SY3, Q86SY4, Q86TR0, Q86U92, Q86U93, Q86U94, Q8N6H4, Q9UPL5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: November 7, 2003
Last modified: February 13, 2019
This is version 167 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again