Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral guanine nucleotide dissociation stimulator-like 2

Gene

RGL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Ral guanine nucleotide dissociation stimulator-like 2
Short name:
RalGDS-like 2
Alternative name(s):
RalGDS-like factor
Ras-associated protein RAB2L
Gene namesi
Name:RGL2
Synonyms:RAB2L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000237441.9
HGNCiHGNC:9769 RGL2
MIMi602306 gene
neXtProtiNX_O15211

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

DisGeNETi5863
OpenTargetsiENSG00000237441
PharmGKBiPA34120

Polymorphism and mutation databases

BioMutaiRGL2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000688881 – 777Ral guanine nucleotide dissociation stimulator-like 2Add BLAST777

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Modified residuei409PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiO15211
MaxQBiO15211
PaxDbiO15211
PeptideAtlasiO15211
PRIDEiO15211
ProteomicsDBi48511

PTM databases

iPTMnetiO15211
PhosphoSitePlusiO15211

Expressioni

Gene expression databases

BgeeiENSG00000237441 Expressed in 227 organ(s), highest expression level in pituitary gland
CleanExiHS_RGL2
ExpressionAtlasiO15211 baseline and differential
GenevisibleiO15211 HS

Organism-specific databases

HPAiHPA047039
HPA053444

Interactioni

Subunit structurei

Interacts with SAMD9.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
NOTCH2NLQ7Z3S93EBI-712355,EBI-945833

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111801, 15 interactors
IntActiO15211, 20 interactors
STRINGi9606.ENSP00000420211

Structurei

3D structure databases

ProteinModelPortaliO15211
SMRiO15211
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini88 – 212N-terminal Ras-GEFPROSITE-ProRule annotationAdd BLAST125
Domaini243 – 513Ras-GEFPROSITE-ProRule annotationAdd BLAST271
Domaini648 – 735Ras-associatingPROSITE-ProRule annotationAdd BLAST88

Phylogenomic databases

eggNOGiENOG410ITRE Eukaryota
ENOG4110VI4 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiO15211
KOiK17636
OMAiDPDIQQW
OrthoDBiEOG091G0761
PhylomeDBiO15211
TreeFamiTF315204

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030749 RGL2
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF213 PTHR23113:SF213, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: O15211-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLPRPLRLLL DTSPPGGVVL SSFRSRDPEE GGGPGGLVVG GGQEEEEEEE
60 70 80 90 100
EEAPVSVWDE EEDGAVFTVT SRQYRPLDPL VPMPPPRSSR RLRAGTLEAL
110 120 130 140 150
VRHLLDTRTS GTDVSFMSAF LATHRAFTST PALLGLMADR LEALESHPTD
160 170 180 190 200
ELERTTEVAI SVLSTWLASH PEDFGSEAKG QLDRLESFLL QTGYAAGKGV
210 220 230 240 250
GGGSADLIRN LRSRVDPQAP DLPKPLALPG DPPADPTDVL VFLADHLAEQ
260 270 280 290 300
LTLLDAELFL NLIPSQCLGG LWGHRDRPGH SHLCPSVRAT VTQFNKVAGA
310 320 330 340 350
VVSSVLGATS TGEGPGEVTI RPLRPPQRAR LLEKWIRVAE ECRLLRNFSS
360 370 380 390 400
VYAVVSALQS SPIHRLRAAW GEATRDSLRV FSSLCQIFSE EDNYSQSREL
410 420 430 440 450
LVQEVKLQSP LEPHSKKAPR SGSRGGGVVP YLGTFLKDLV MLDAASKDEL
460 470 480 490 500
ENGYINFDKR RKEFAVLSEL RRLQNECRGY NLQPDHDIQR WLQGLRPLTE
510 520 530 540 550
AQSHRVSCEV EPPGSSDPPA PRVLRPTLVI SQWTEVLGSV GVPTPLVSCD
560 570 580 590 600
RPSTGGDEAP TTPAPLLTRL AQHMKWPSVS SLDSALESSP SLHSPADPSH
610 620 630 640 650
LSPPASSPRP SRGHRRSASC GSPLSGGAEE ASGGTGYGGE GSGPGASDCR
660 670 680 690 700
IIRVQMELGE DGSVYKSILV TSQDKAPSVI SRVLKKNNRD SAVASEYELV
710 720 730 740 750
QLLPGERELT IPASANVFYA MDGASHDFLL RQRRRSSTAT PGVTSGPSAS
760 770
GTPPSEGGGG SFPRIKATGR KIARALF
Length:777
Mass (Da):83,549
Last modified:January 1, 1998 - v1
Checksum:i91AFBAB4D6CEE4A1
GO
Isoform 2 (identifier: O15211-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.
     462-462: K → KVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQ
     504-777: Missing.

Note: No experimental confirmation available.
Show »
Length:460
Mass (Da):50,224
Checksum:i131449D7441590D0
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AB89A2AB89_HUMAN
Ral guanine nucleotide dissociation...
RGL2
146Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti503S → R in BAG57683 (PubMed:14702039).Curated1
Sequence conflicti720A → P in BAA75926 (PubMed:8976381).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051903598P → L. Corresponds to variant dbSNP:rs34022110Ensembl.1
Natural variantiVAR_051904705G → E. Corresponds to variant dbSNP:rs35273540Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0558471 – 82Missing in isoform 2. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_055848462K → KVSGVSGLDAGLPYPCSRKG RGKSQGSLSFGSCSLRAPSQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_055849504 – 777Missing in isoform 2. 1 PublicationAdd BLAST274

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA Translation: CAB09992.1
AL050259 mRNA Translation: CAB43361.1
AK294442 mRNA Translation: BAG57683.1
AL662820 Genomic DNA No translation available.
AL662827 Genomic DNA No translation available.
BX000343 Genomic DNA No translation available.
CR759786 Genomic DNA No translation available.
CR759817 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03709.1
BC032681 mRNA Translation: AAH32681.1
D85757 mRNA Translation: BAA75926.1
CCDSiCCDS4774.1 [O15211-1]
PIRiT08659
RefSeqiNP_001230667.1, NM_001243738.1
NP_004752.1, NM_004761.4 [O15211-1]
UniGeneiHs.509622

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282 [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841 [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736 [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825 [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441 [O15211-1]
GeneIDi5863
KEGGihsa:5863
UCSCiuc003odv.4 human [O15211-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z97184 Genomic DNA Translation: CAB09992.1
AL050259 mRNA Translation: CAB43361.1
AK294442 mRNA Translation: BAG57683.1
AL662820 Genomic DNA No translation available.
AL662827 Genomic DNA No translation available.
BX000343 Genomic DNA No translation available.
CR759786 Genomic DNA No translation available.
CR759817 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03709.1
BC032681 mRNA Translation: AAH32681.1
D85757 mRNA Translation: BAA75926.1
CCDSiCCDS4774.1 [O15211-1]
PIRiT08659
RefSeqiNP_001230667.1, NM_001243738.1
NP_004752.1, NM_004761.4 [O15211-1]
UniGeneiHs.509622

3D structure databases

ProteinModelPortaliO15211
SMRiO15211
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111801, 15 interactors
IntActiO15211, 20 interactors
STRINGi9606.ENSP00000420211

PTM databases

iPTMnetiO15211
PhosphoSitePlusiO15211

Polymorphism and mutation databases

BioMutaiRGL2

Proteomic databases

EPDiO15211
MaxQBiO15211
PaxDbiO15211
PeptideAtlasiO15211
PRIDEiO15211
ProteomicsDBi48511

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383204; ENSP00000372691; ENSG00000206282 [O15211-1]
ENST00000413136; ENSP00000407088; ENSG00000224841 [O15211-1]
ENST00000416548; ENSP00000412152; ENSG00000228736 [O15211-1]
ENST00000452084; ENSP00000390098; ENSG00000237825 [O15211-1]
ENST00000497454; ENSP00000420211; ENSG00000237441 [O15211-1]
GeneIDi5863
KEGGihsa:5863
UCSCiuc003odv.4 human [O15211-1]

Organism-specific databases

CTDi5863
DisGeNETi5863
EuPathDBiHostDB:ENSG00000237441.9
GeneCardsiRGL2
HGNCiHGNC:9769 RGL2
HPAiHPA047039
HPA053444
MIMi602306 gene
neXtProtiNX_O15211
OpenTargetsiENSG00000237441
PharmGKBiPA34120
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITRE Eukaryota
ENOG4110VI4 LUCA
GeneTreeiENSGT00910000143985
HOGENOMiHOG000231592
HOVERGENiHBG005864
InParanoidiO15211
KOiK17636
OMAiDPDIQQW
OrthoDBiEOG091G0761
PhylomeDBiO15211
TreeFamiTF315204

Miscellaneous databases

ChiTaRSiRGL2 human
GeneWikiiRGL2
GenomeRNAii5863
PROiPR:O15211
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000237441 Expressed in 227 organ(s), highest expression level in pituitary gland
CleanExiHS_RGL2
ExpressionAtlasiO15211 baseline and differential
GenevisibleiO15211 HS

Family and domain databases

CDDicd00155 RasGEF, 1 hit
cd06224 REM, 1 hit
Gene3Di1.10.840.10, 1 hit
InterProiView protein in InterPro
IPR000159 RA_dom
IPR008937 Ras-like_GEF
IPR000651 Ras-like_Gua-exchang_fac_N
IPR019804 Ras_G-nucl-exch_fac_CS
IPR023578 Ras_GEF_dom_sf
IPR001895 RASGEF_cat_dom
IPR036964 RASGEF_cat_dom_sf
IPR030749 RGL2
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR23113 PTHR23113, 1 hit
PTHR23113:SF213 PTHR23113:SF213, 1 hit
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00617 RasGEF, 1 hit
PF00618 RasGEF_N, 1 hit
SMARTiView protein in SMART
SM00314 RA, 1 hit
SM00147 RasGEF, 1 hit
SM00229 RasGEFN, 1 hit
SUPFAMiSSF48366 SSF48366, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS00720 RASGEF, 1 hit
PS50009 RASGEF_CAT, 1 hit
PS50212 RASGEF_NTER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRGL2_HUMAN
AccessioniPrimary (citable) accession number: O15211
Secondary accession number(s): B4DG72, Q5STK0, Q9Y3F3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: January 1, 1998
Last modified: November 7, 2018
This is version 162 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again