Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (13 Nov 2019)
Sequence version 1 (01 Jan 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Low-density lipoprotein receptor class A domain-containing protein 4

Gene

LDLRAD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionSignal transduction inhibitor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Low-density lipoprotein receptor class A domain-containing protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LDLRAD4
Synonyms:C18orf1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1224 LDLRAD4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606571 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_O15165

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 64LumenalSequence analysisAdd BLAST64
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei65 – 85HelicalSequence analysisAdd BLAST21
Topological domaini86 – 306CytoplasmicSequence analysisAdd BLAST221

Keywords - Cellular componenti

Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
753

Open Targets

More...
OpenTargetsi
ENSG00000168675

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25593

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
O15165

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LDLRAD4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001854441 – 306Low-density lipoprotein receptor class A domain-containing protein 4Add BLAST306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi19 ↔ 38PROSITE-ProRule annotation
Disulfide bondi32 ↔ 47PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
O15165

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
O15165

PeptideAtlas

More...
PeptideAtlasi
O15165

PRoteomics IDEntifications database

More...
PRIDEi
O15165

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19107
48486 [O15165-1]
48487 [O15165-2]
48488 [O15165-3]
48489 [O15165-4]
48490 [O15165-5]
48491 [O15165-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
O15165

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
O15165

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
O15165

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in lymphocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168675 Expressed in 214 organ(s), highest expression level in caudate nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
O15165 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
O15165 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047633
HPA054556
HPA065246

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PMEPA1.

Interacts (via the SMAD interaction motif) with SMAD2 and SMAD3.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107209, 52 interactors

Protein interaction database and analysis system

More...
IntActi
O15165, 41 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352420

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
O15165

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 48LDL-receptor class APROSITE-ProRule annotationAdd BLAST33

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi180 – 183PPxY motif 14
Motifi208 – 211SMAD interaction motif (SIM)4
Motifi252 – 255PPxY motif 24

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SMAD interaction motif is required for interaction with SMAD2 and SMAD3 and the negative regulation of TGF-beta signaling.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PMEPA1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IDYQ Eukaryota
ENOG41126PF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000724

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000276535

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
O15165

Identification of Orthologs from Complete Genome Data

More...
OMAi
LWPSESS

Database of Orthologous Groups

More...
OrthoDBi
1189277at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
O15165

TreeFam database of animal gene trees

More...
TreeFami
TF331681

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112 LDLa, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.400.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00057 Ldl_recept_a, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00192 LDLa, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57424 SSF57424, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01209 LDLRA_1, 1 hit
PS50068 LDLRA_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha-1 (identifier: O15165-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPEAGFQATN AFTECKFTCT SGKCLYLGSL VCNQQNDCGD NSDEENCLLV
60 70 80 90 100
TEHPPPGIFN SELEFAQIII IVVVVTVMVV VIVCLLNHYK VSTRSFINRP
110 120 130 140 150
NQSRRREDGL PQEGCLWPSD SAAPRLGASE IMHAPRSRDR FTAPSFIQRD
160 170 180 190 200
RFSRFQPTYP YVQHEIDLPP TISLSDGEEP PPYQGPCTLQ LRDPEQQMEL
210 220 230 240 250
NRESVRAPPN RTIFDSDLID IAMYSGGPCP PSSNSGISAS TCSSNGRMEG
260 270 280 290 300
PPPTYSEVMG HHPGASFLHH QRSNAHRGSR LQFQQNNAES TIVPIKGKDR

KPGNLV
Length:306
Mass (Da):33,900
Last modified:January 1, 1998 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF48EF66E329201BD
GO
Isoform Alpha-2 (identifier: O15165-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     113-130: Missing.

Show »
Length:288
Mass (Da):32,072
Checksum:iB7DEC603B9C5CA79
GO
Isoform Beta-1 (identifier: O15165-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA

Show »
Length:248
Mass (Da):27,600
Checksum:iB88763A5A86C970A
GO
Isoform Beta-2 (identifier: O15165-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNS → MAA
     113-130: Missing.

Show »
Length:230
Mass (Da):25,772
Checksum:i4EA79478440BC7C0
GO
Isoform 5 (identifier: O15165-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: Missing.

Show »
Length:229
Mass (Da):25,560
Checksum:iD124C6E3503B031E
GO
Isoform 6 (identifier: O15165-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA

Note: No experimental confirmation available.
Show »
Length:269
Mass (Da):30,075
Checksum:iBC8B8A807F64B908
GO
Isoform 7 (identifier: O15165-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MPEAGFQATN...EHPPPGIFNS → MSSDHLNNSTLKEAQFKDLFLKKA
     113-130: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):28,247
Checksum:iBD0751CEB806A1B7
GO
Isoform 8 (identifier: O15165-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-111: MPEAGFQATN...QSRRREDGLP → MRLDSHLECISST

Note: No experimental confirmation available.
Show »
Length:208
Mass (Da):23,053
Checksum:iC12FA9F28364B0C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EJM9K7EJM9_HUMAN
Low-density lipoprotein receptor cl...
LDLRAD4
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKD6K7EKD6_HUMAN
Low-density lipoprotein receptor cl...
LDLRAD4
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMG1K7EMG1_HUMAN
Low-density lipoprotein receptor cl...
LDLRAD4
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti125R → Q in AAH66971 (PubMed:15489334).Curated1
Sequence conflicti135P → T in AAH66971 (PubMed:15489334).Curated1
Sequence conflicti194P → T in AAH66971 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0547721 – 111MPEAG…EDGLP → MRLDSHLECISST in isoform 8. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_0139011 – 77Missing in isoform 5. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_0432531 – 61MPEAG…GIFNS → MSSDHLNNSTLKEAQFKDLF LKKA in isoform 6 and isoform 7. 2 PublicationsAdd BLAST61
Alternative sequenceiVSP_0064391 – 61MPEAG…GIFNS → MAA in isoform Beta-1 and isoform Beta-2. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_006440113 – 130Missing in isoform Alpha-2, isoform Beta-2 and isoform 7. 3 PublicationsAdd BLAST18

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF009424 mRNA Translation: AAC52023.1
AF009425 mRNA Translation: AAC52024.1
AF009426 mRNA Translation: AAC52025.1
AF009427 mRNA Translation: AAC52026.1
AK055028 mRNA Translation: BAG51451.1
AP001010 Genomic DNA No translation available.
AP002439 Genomic DNA No translation available.
AP002505 Genomic DNA No translation available.
AP005131 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01514.1
BC029958 mRNA No translation available.
BC030199 mRNA Translation: AAH30199.1
BC066971 mRNA Translation: AAH66971.1
BX114947 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32793.1 [O15165-1]
CCDS32794.1 [O15165-2]
CCDS32795.1 [O15165-6]
CCDS42415.1 [O15165-7]
CCDS62392.1 [O15165-5]
CCDS62393.1 [O15165-8]

NCBI Reference Sequences

More...
RefSeqi
NP_001003674.1, NM_001003674.3 [O15165-6]
NP_001003675.1, NM_001003675.3 [O15165-7]
NP_001263178.1, NM_001276249.1 [O15165-5]
NP_001263180.1, NM_001276251.1 [O15165-8]
NP_852146.1, NM_181481.4 [O15165-1]
NP_852147.1, NM_181482.4 [O15165-2]
XP_005258197.1, XM_005258140.1 [O15165-1]
XP_006722416.1, XM_006722353.1 [O15165-1]
XP_006722417.1, XM_006722354.1 [O15165-1]
XP_011524040.1, XM_011525738.1 [O15165-5]
XP_016881454.1, XM_017025965.1 [O15165-5]
XP_016881455.1, XM_017025966.1 [O15165-5]
XP_016881456.1, XM_017025967.1 [O15165-5]
XP_016881457.1, XM_017025968.1 [O15165-5]
XP_016881458.1, XM_017025969.1 [O15165-5]
XP_016881459.1, XM_017025970.1 [O15165-5]
XP_016881460.1, XM_017025971.1 [O15165-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359446; ENSP00000352420; ENSG00000168675 [O15165-1]
ENST00000399848; ENSP00000382741; ENSG00000168675 [O15165-2]
ENST00000585931; ENSP00000466772; ENSG00000168675 [O15165-5]
ENST00000586765; ENSP00000474783; ENSG00000168675 [O15165-7]
ENST00000587757; ENSP00000466178; ENSG00000168675 [O15165-6]
ENST00000592991; ENSP00000466771; ENSG00000168675 [O15165-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
753

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:753

UCSC genome browser

More...
UCSCi
uc002ksb.4 human [O15165-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF009424 mRNA Translation: AAC52023.1
AF009425 mRNA Translation: AAC52024.1
AF009426 mRNA Translation: AAC52025.1
AF009427 mRNA Translation: AAC52026.1
AK055028 mRNA Translation: BAG51451.1
AP001010 Genomic DNA No translation available.
AP002439 Genomic DNA No translation available.
AP002505 Genomic DNA No translation available.
AP005131 Genomic DNA No translation available.
CH471113 Genomic DNA Translation: EAX01514.1
BC029958 mRNA No translation available.
BC030199 mRNA Translation: AAH30199.1
BC066971 mRNA Translation: AAH66971.1
BX114947 mRNA No translation available.
CCDSiCCDS32793.1 [O15165-1]
CCDS32794.1 [O15165-2]
CCDS32795.1 [O15165-6]
CCDS42415.1 [O15165-7]
CCDS62392.1 [O15165-5]
CCDS62393.1 [O15165-8]
RefSeqiNP_001003674.1, NM_001003674.3 [O15165-6]
NP_001003675.1, NM_001003675.3 [O15165-7]
NP_001263178.1, NM_001276249.1 [O15165-5]
NP_001263180.1, NM_001276251.1 [O15165-8]
NP_852146.1, NM_181481.4 [O15165-1]
NP_852147.1, NM_181482.4 [O15165-2]
XP_005258197.1, XM_005258140.1 [O15165-1]
XP_006722416.1, XM_006722353.1 [O15165-1]
XP_006722417.1, XM_006722354.1 [O15165-1]
XP_011524040.1, XM_011525738.1 [O15165-5]
XP_016881454.1, XM_017025965.1 [O15165-5]
XP_016881455.1, XM_017025966.1 [O15165-5]
XP_016881456.1, XM_017025967.1 [O15165-5]
XP_016881457.1, XM_017025968.1 [O15165-5]
XP_016881458.1, XM_017025969.1 [O15165-5]
XP_016881459.1, XM_017025970.1 [O15165-5]
XP_016881460.1, XM_017025971.1 [O15165-5]

3D structure databases

SMRiO15165
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107209, 52 interactors
IntActiO15165, 41 interactors
STRINGi9606.ENSP00000352420

PTM databases

iPTMnetiO15165
PhosphoSitePlusiO15165
SwissPalmiO15165

Polymorphism and mutation databases

BioMutaiLDLRAD4

Proteomic databases

MassIVEiO15165
PaxDbiO15165
PeptideAtlasiO15165
PRIDEiO15165
ProteomicsDBi19107
48486 [O15165-1]
48487 [O15165-2]
48488 [O15165-3]
48489 [O15165-4]
48490 [O15165-5]
48491 [O15165-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
753

Genome annotation databases

EnsembliENST00000359446; ENSP00000352420; ENSG00000168675 [O15165-1]
ENST00000399848; ENSP00000382741; ENSG00000168675 [O15165-2]
ENST00000585931; ENSP00000466772; ENSG00000168675 [O15165-5]
ENST00000586765; ENSP00000474783; ENSG00000168675 [O15165-7]
ENST00000587757; ENSP00000466178; ENSG00000168675 [O15165-6]
ENST00000592991; ENSP00000466771; ENSG00000168675 [O15165-8]
GeneIDi753
KEGGihsa:753
UCSCiuc002ksb.4 human [O15165-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
753
DisGeNETi753

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LDLRAD4
HGNCiHGNC:1224 LDLRAD4
HPAiHPA047633
HPA054556
HPA065246
MIMi606571 gene
neXtProtiNX_O15165
OpenTargetsiENSG00000168675
PharmGKBiPA25593

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IDYQ Eukaryota
ENOG41126PF LUCA
GeneTreeiENSGT00390000000724
HOGENOMiHOG000276535
InParanoidiO15165
OMAiLWPSESS
OrthoDBi1189277at2759
PhylomeDBiO15165
TreeFamiTF331681

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LDLRAD4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
753
PharosiO15165

Protein Ontology

More...
PROi
PR:O15165

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168675 Expressed in 214 organ(s), highest expression level in caudate nucleus
ExpressionAtlasiO15165 baseline and differential
GenevisibleiO15165 HS

Family and domain databases

CDDicd00112 LDLa, 1 hit
Gene3Di4.10.400.10, 1 hit
InterProiView protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt
PfamiView protein in Pfam
PF00057 Ldl_recept_a, 1 hit
SMARTiView protein in SMART
SM00192 LDLa, 1 hit
SUPFAMiSSF57424 SSF57424, 1 hit
PROSITEiView protein in PROSITE
PS01209 LDLRA_1, 1 hit
PS50068 LDLRA_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRAD4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: O15165
Secondary accession number(s): B3KNT9
, E9PAY9, K7EN38, O15166, O15167, O15168, Q5U646, Q6NXP3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: January 1, 1998
Last modified: November 13, 2019
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again